Protein Info for SGL_RS03310 in Synechocystis sp000284455 PCC 6803

Annotation: SUMF1/EgtB/PvdO family nonheme iron enzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 410 TIGR03440: ergothioneine biosynthesis protein EgtB" amino acids 10 to 409 (400 residues), 328 bits, see alignment E=5.8e-102 PF03781: FGE-sulfatase" amino acids 167 to 409 (243 residues), 262.9 bits, see alignment E=3.6e-82

Best Hits

KEGG orthology group: None (inferred from 100% identity to syn:slr1303)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (410 amino acids)

>SGL_RS03310 SUMF1/EgtB/PvdO family nonheme iron enzyme (Synechocystis sp000284455 PCC 6803)
MVENLETIDQAMERCRTETLRLLHRIPPTLGDRQWHPDFSPIDWHFGHIAFTEALWLLPE
QERKKFHTPSYQKLFRADGLSKSERCALPSRGVIEQYLGEVRASVKQVWGSTDRSWDRAQ
ARLRWWLLQHEVQHSETISFLSHLAGIDLGVNSQIPGDECPEPVLEATMVPIPAGGFYQG
SEQIWAQDNERPVHWVEVEQFWLDKYPVTQAQYQQFIDAGGYQQSKYWTEAGWQWRSMAN
VTAPLYWHPESNTQNHPVYGVSAYEAEAYANFVGKRLPTEQEWERAARWSGQHNSSTYPW
EETLPTKEQCNFNNHRGRTTPVHYYDQGRNQGGCYDLLGNVWEWTASTFEPYDNFQPYPY
RGYSQAYFDGEHRVMRGGSWATRSWGLRASFRNWYHPWTRQVLVGFRCAS