Protein Info for SGL_RS02895 in Synechocystis sp000284455 PCC 6803

Annotation: glutamate synthase small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 494 TIGR01317: glutamate synthase, NADH/NADPH, small subunit" amino acids 3 to 494 (492 residues), 871.8 bits, see alignment E=6.9e-267 PF14691: Fer4_20" amino acids 24 to 140 (117 residues), 70.5 bits, see alignment E=5.3e-23 PF07992: Pyr_redox_2" amino acids 153 to 476 (324 residues), 94.9 bits, see alignment E=3.2e-30 PF00070: Pyr_redox" amino acids 154 to 188 (35 residues), 22.6 bits, see alignment 6.4e-08 PF00890: FAD_binding_2" amino acids 155 to 189 (35 residues), 23.3 bits, see alignment 1.8e-08 PF13450: NAD_binding_8" amino acids 157 to 190 (34 residues), 37.8 bits, see alignment (E = 9.4e-13) PF01593: Amino_oxidase" amino acids 163 to 190 (28 residues), 28.1 bits, see alignment (E = 6.4e-10)

Best Hits

Swiss-Prot: 57% identical to GLTB_BACSU: Glutamate synthase [NADPH] small chain (gltB) from Bacillus subtilis (strain 168)

KEGG orthology group: K00266, glutamate synthase (NADPH/NADH) small chain [EC: 1.4.1.13 1.4.1.14] (inferred from 100% identity to syn:sll1027)

Predicted SEED Role

"Glutamate synthase [NADPH] small chain (EC 1.4.1.13)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 1.4.1.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.13, 1.4.1.14

Use Curated BLAST to search for 1.4.1.13 or 1.4.1.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (494 amino acids)

>SGL_RS02895 glutamate synthase small subunit (Synechocystis sp000284455 PCC 6803)
MGKPTGFLEYTREIPQELSPGDRLRNWDEFHVTMPDKQVETQGARCMDCGTPFCHTGSLI
SGMASGCPINNLIPEFNDLVYRGLWREALDRLHKTNNFPEFTGRVCPAPCEGSCVLGINN
PPVTIKNIEYSIIEKGWQEGWVTPEPPAKRTGKKVAVVGSGPAGLAAAAQLNKAGHWVTV
YEREDRPGGLLMYGIPNMKLDKEEVVLRRLNVLEAEGVTFVCNTEIGKDLPPETLLKDYD
AVVLCTGATKPRDLAIAGRELEGIHFAMEFLTANTKAILDKTPGPNFISAKDKDVVIIGG
GDTGTDCVGTSLRHGCRSLVQLEIMPKPPEERAANNPWPEWPKVYKMDYGQEEAAAVYGH
DPRSYLTTATKIEGDDQGRVKAVHTVDVRWEKDGQGRFIPQQVAGTEQVRPAQLVLLAMG
FVGPESQLLDAMKLDKDARGNIKAEYGQYETSIPGVFAAGDCRRGQSLVVWAFNEGRGAA
KACDLYLMGETDLP