Protein Info for SGL_RS02750 in Synechocystis sp000284455 PCC 6803

Annotation: mechanosensitive ion channel family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 763 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 297 to 321 (25 residues), see Phobius details amino acids 427 to 454 (28 residues), see Phobius details amino acids 467 to 492 (26 residues), see Phobius details amino acids 519 to 541 (23 residues), see Phobius details amino acids 546 to 566 (21 residues), see Phobius details PF00924: MS_channel_2nd" amino acids 564 to 629 (66 residues), 67.4 bits, see alignment E=9.7e-23 PF21082: MS_channel_3rd" amino acids 635 to 721 (87 residues), 64.2 bits, see alignment E=1.2e-21

Best Hits

KEGG orthology group: None (inferred from 100% identity to syn:sll1040)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (763 amino acids)

>SGL_RS02750 mechanosensitive ion channel family protein (Synechocystis sp000284455 PCC 6803)
MGCRFATVKRLILLGLLAFTLAVLIPPATAQITLSSGGNNGSQNTSSTPWWDTNKARRCG
RLWCSDVFLQGSSQVTFTVGLIPNPEESSQAAAQAIENRAKQVESIFNSIYSRLISLNTV
EIPEKDVQFLRSKVFDLRESRLGYHSNPSNWPGTSPAPPNSRDSTTTAPEINQNNQESSS
VERRTPTTSFRNAPQSAIRIISSPAPNLANVAADEIHPFTPNVEVGIQNNETVIFVPSQP
SLGLAQQTIVTVNQADEIINGKPINLLAHEWRDRIQSSFDKALWGHELDRQHPWDRYYIS
GAFMVVALAIVTIMGLIRSFFYRRDRYLRQELKVLAQSITKDIEAESAESVRLASQEVSE
FPELGPDRQGEEGQNGHGSPSKERNFPLYVPLADQVRDRVNHAWQNIGDLASSNLRRQTL
LKQRRNLAVLMCWILLWLQISCIFIVGAFIVYVFPSTRPFTLLFIGQAMYFPLLWIGVTL
IDKVCGIFVDGLLNNWAKEQQSYNEHSNRYTLRVMTYSPAIKGGISVLLTILGILGTIWL
FGINPLVLASFGGVAFVLAFLGRNVVEDMLNGTLILWTDRYAIGDVVQIGDVFGLVENMN
IYITQLRGPEGRLSTIPNGKISVVQNLTKDWSRAEFIVEIDQSSNVDKALNLIRVVSEQM
REDPLWQEKILEPAAILGVDDIASKGIRLQVWIKTQAGQHWPVGREFRLRMKKAFELAGI
ALGAPQQRIVYHHHGQKSSHSNGKTDHSPGAIALGPNFPKEYN