Protein Info for SGL_RS01555 in Synechocystis sp000284455 PCC 6803

Annotation: two-component system sensor histidine kinase RppB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 transmembrane" amino acids 15 to 34 (20 residues), see Phobius details amino acids 185 to 205 (21 residues), see Phobius details PF00512: HisKA" amino acids 220 to 282 (63 residues), 60.7 bits, see alignment E=1.1e-20 PF02518: HATPase_c" amino acids 333 to 442 (110 residues), 101.5 bits, see alignment E=3.8e-33

Best Hits

KEGG orthology group: None (inferred from 100% identity to syn:slr6041)

Predicted SEED Role

"Two component system histidine kinase (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (450 amino acids)

>SGL_RS01555 two-component system sensor histidine kinase RppB (Synechocystis sp000284455 PCC 6803)
MQNNRLFNLSRWRLASYYAGVMGLILGLCGLAVYEMTSQDHWRSLDQELTSLAGTLHDGL
EPLLQQPGQLEPSVKQILPNLCLGTVACPRSPQRRHILNATQQPGYYVRFLDLNGQLLAT
AGENPPGLAFERETTRQKPLTDQKGNRYHQVSLLLKTTTGEPWGYLKVGRSLVEYDHHLH
TIQGFLVWGLPIVMIVVGGASWWLAGLAMEPVYRSYQQIQQFTADIAHELRTPITAIQAT
LETTLNAEPNAEETHSTLQTLKRQNYRLSHLIHDLLLLSRMDLTTVNPTQFTLCCLNDLV
EDLTEEFASLAIAAGVLLSAKLDNQANIWVRGEEEQLYRLVGNLISNAIHYTPTGGEVTV
MLETDKQQAIIKVQDTGIGIASENQSRVFDRFYRVDTARSRQRGGAGLGLAIAQAIAVKH
RGSLTVESELGQGSLFTVQLPLVSAPIVQS