Protein Info for Rv3917c in Mycobacterium tuberculosis H37Rv

Annotation: Probable chromosome partitioning protein ParB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF02195: ParB_N" amino acids 57 to 155 (99 residues), 116.9 bits, see alignment E=6.4e-38 TIGR00180: ParB/RepB/Spo0J family partition protein" amino acids 60 to 241 (182 residues), 216.7 bits, see alignment E=1.1e-68 PF17762: HTH_ParB" amino acids 159 to 256 (98 residues), 114.5 bits, see alignment E=3.7e-37 PF23552: ParB_C" amino acids 286 to 327 (42 residues), 24.6 bits, see alignment 2.1e-09

Best Hits

Swiss-Prot: 100% identical to PARB_MYCTO: Probable chromosome-partitioning protein ParB (parB) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K03497, chromosome partitioning protein, ParB family (inferred from 100% identity to mtb:TBMG_03965)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (344 amino acids)

>Rv3917c Probable chromosome partitioning protein ParB (Mycobacterium tuberculosis H37Rv)
MTQPSRRKGGLGRGLAALIPTGPADGESGPPTLGPRMGSATADVVIGGPVPDTSVMGAIY
REIPPSAIEANPRQPRQVFDEEALAELVHSIREFGLLQPIVVRSLAGSQTGVRYQIVMGE
RRWRAAQEAGLATIPAIVRETGDDNLLRDALLENIHRVQLNPLEEAAAYQQLLDEFGVTH
DELAARIGRSRPLITNMIRLLKLPIPVQRRVAAGVLSAGHARALLSLEAGPEAQEELASR
IVAEGLSVRATEETVTLANHEANRQAHHSDATTPAPPRRKPIQMPGLQDVAERLSTTFDT
RVTVSLGKRKGKIVVEFGSVDDLARIVGLMTTDGRDKGLHRDAL