Protein Info for Rv3910 in Mycobacterium tuberculosis H37Rv

Annotation: Probable conserved transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1000 1100 1184 transmembrane" amino acids 31 to 36 (6 residues), see Phobius details amino acids 43 to 63 (21 residues), see Phobius details amino acids 69 to 88 (20 residues), see Phobius details amino acids 106 to 128 (23 residues), see Phobius details amino acids 146 to 167 (22 residues), see Phobius details amino acids 178 to 197 (20 residues), see Phobius details amino acids 213 to 235 (23 residues), see Phobius details amino acids 255 to 275 (21 residues), see Phobius details amino acids 293 to 314 (22 residues), see Phobius details amino acids 341 to 365 (25 residues), see Phobius details amino acids 374 to 395 (22 residues), see Phobius details amino acids 407 to 430 (24 residues), see Phobius details amino acids 437 to 460 (24 residues), see Phobius details amino acids 480 to 497 (18 residues), see Phobius details amino acids 517 to 537 (21 residues), see Phobius details amino acids 979 to 1001 (23 residues), see Phobius details TIGR01695: murein biosynthesis integral membrane protein MurJ" amino acids 23 to 545 (523 residues), 245.2 bits, see alignment E=6.5e-77 PF03023: MurJ" amino acids 48 to 521 (474 residues), 423 bits, see alignment E=6.7e-131

Best Hits

Swiss-Prot: 100% identical to MVINL_MYCTO: Probable peptidoglycan biosynthesis protein MviN (mviN) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K03980, virulence factor (inferred from 100% identity to mtu:Rv3910)

Predicted SEED Role

"Integral membrane protein MviN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (1184 amino acids)

>Rv3910 Probable conserved transmembrane protein (Mycobacterium tuberculosis H37Rv)
MRPSPGEVPTASQRQPELSDAALVSHSWAMAFATLISRITGFARIVLLAAILGAALASSF
SVANQLPNLVAALVLEATFTAIFVPVLARAEQDDPDGGAAFVRRLVTLATTLLLGATTLS
VLAAPLLVRLMLGTNPQVNEPLTTAFAYLLLPQVLVYGLSSVFMAILNTRNVFGPPAWAP
VVNNVVAIATLAVYLAVPGELSVDPVRMGNAKLLVLGIGTTAGVFAQTAVLLVAIRREHI
SLRPLWGIDQRLKRFGAMAAAMVLYVLISQLGLVVGNRIASTAAASGPAIYNYTWLVLML
PFGMIGVTVLTVVMPRLSRNAAADDTPAVLADLSLATRLTMITLIPTVAFMTVGGPAIGS
ALFAYGNFGDVDAGYLGAAIALSAFTLIPYALVLLQLRVFYAREQPWTPITIIVVITGVK
ILGSLLAPHITGDPQLVAAYLGLANGLGFLAGTIVGYYILRRALRPDGGQLIGVGEARTV
LVTVAASLLAGLLAHVADRLLGLSELTAHAGSVGSLLRLSVLALIMLPILAAVTLCARVP
EARAALDAVRARIRSRRLKTGPQTQNVLDQSSRPGPVTYPERRRLAPPRGKSVVHEPIRR
RPPEQVARAGRAKGPEVIDRPSENASFGAASGAELPRPVADELQLDAPAGRDPGPVSRPH
PSDLQNGDLPADAARGPIAFDALREPDRESSAPPDDVQLVPGARIANGRYRLLIFHGGVP
PLQFWQALDTALDRQVALTFVDPQGVLPDDVLQETLSRTLRLSRIDKPGVARVLDVVHTR
AGGLVVAEWIRGGSLQEVADTSPSPVGAIRAMQSLAAAADAAHRAGVALSIDHPSRVRVS
IDGDVVLAYPATMPDANPQDDIRGIGASLYALLVNRWPLPEAGVRSGLAPAERDTAGQPI
EPADIDRDIPFQISAVAARSVQGDGGIRSASTLLNLMQQATAVADRTEVLGPIDEAPVSA
APRTSAPNSETYTRRRRNLLIGIGAGAAVLMVALLVLASVLSRIFGDVSGGLNKDELGLN
APTASTSAASSAPPGSVVKPTKVTVFSPDGGADNPGEADLAIDGNPATSWKTDIYTDPVP
FPSFKNGVGLMLQLPQATVVGTVAIDVASTGTKVEIRSASTPTPATLEDTAVLTSATALR
PGHNTISVEAAAPTSNLLVWISTLGTTDGKSQADISEITIYAAS