Protein Info for Rv3875 in Mycobacterium tuberculosis H37Rv

Annotation: 6 kDa early secretory antigenic target EsxA (ESAT-6)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 95 TIGR03930: WXG100 family type VII secretion target" amino acids 5 to 89 (85 residues), 64.9 bits, see alignment E=2.9e-22 PF06013: WXG100" amino acids 5 to 87 (83 residues), 63.6 bits, see alignment E=8.2e-22

Best Hits

Swiss-Prot: 100% identical to ESXA_MYCBO: 6 kDa early secretory antigenic target (esxA) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: K14956, 6 kDa early secretory antigenic target (inferred from 100% identity to mbo:Mb3905)

Predicted SEED Role

"6 kDa early secretory antigenic target ESAT-6 (EsxA)" in subsystem ESAT-6 proteins secretion system in Actinobacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (95 amino acids)

>Rv3875 6 kDa early secretory antigenic target EsxA (ESAT-6) (Mycobacterium tuberculosis H37Rv)
MTEQQWNFAGIEAAASAIQGNVTSIHSLLDEGKQSLTKLAAAWGGSGSEAYQGVQQKWDA
TATELNNALQNLARTISEAGQAMASTEGNVTGMFA