Protein Info for Rv3869 in Mycobacterium tuberculosis H37Rv

Annotation: ESX conserved component EccB1. ESX-1 type VII secretion system protein. Possible membrane protein.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 480 transmembrane" amino acids 40 to 64 (25 residues), see Phobius details PF05108: T7SS_ESX1_EccB" amino acids 4 to 464 (461 residues), 569.6 bits, see alignment E=2.7e-175 TIGR03919: type VII secretion protein EccB" amino acids 6 to 452 (447 residues), 560.1 bits, see alignment E=1.9e-172

Best Hits

Swiss-Prot: 100% identical to ECCB1_MYCTU: ESX-1 secretion system ATPase EccB1 (eccB1) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mbo:Mb3899)

Predicted SEED Role

"Membrane protein EccB1, component of Type VII secretion system ESX-1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (480 amino acids)

>Rv3869 ESX conserved component EccB1. ESX-1 type VII secretion system protein. Possible membrane protein. (Mycobacterium tuberculosis H37Rv)
MGLRLTTKVQVSGWRFLLRRLEHAIVRRDTRMFDDPLQFYSRSIALGIVVAVLILAGAAL
LAYFKPQGKLGGTSLFTDRATNQLYVLLSGQLHPVYNLTSARLVLGNPANPATVKSSELS
KLPMGQTVGIPGAPYATPVSAGSTSIWTLCDTVARADSTSPVVQTAVIAMPLEIDASIDP
LQSHEAVLVSYQGETWIVTTKGRHAIDLTDRALTSSMGIPVTARPTPISEGMFNALPDMG
PWQLPPIPAAGAPNSLGLPDDLVIGSVFQIHTDKGPQYYVVLPDGIAQVNATTAAALRAT
QAHGLVAPPAMVPSLVVRIAERVYPSPLPDEPLKIVSRPQDPALCWSWQRSAGDQSPQST
VLSGRHLPISPSAMNMGIKQIHGTATVYLDGGKFVALQSPDPRYTESMYYIDPQGVRYGV
PNAETAKSLGLSSPQNAPWEIVRLLVDGPVLSKDAALLEHDTLPADPSPRKVPAGASGAP