Protein Info for Rv3848 in Mycobacterium tuberculosis H37Rv

Annotation: Probable conserved transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 34 to 56 (23 residues), see Phobius details amino acids 67 to 84 (18 residues), see Phobius details amino acids 136 to 159 (24 residues), see Phobius details amino acids 167 to 185 (19 residues), see Phobius details amino acids 191 to 213 (23 residues), see Phobius details PF01169: GDT1" amino acids 8 to 80 (73 residues), 65.4 bits, see alignment E=2.5e-22 amino acids 107 to 180 (74 residues), 76.1 bits, see alignment E=1.1e-25

Best Hits

KEGG orthology group: None (inferred from 100% identity to mbo:Mb3878)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (302 amino acids)

>Rv3848 Probable conserved transmembrane protein (Mycobacterium tuberculosis H37Rv)
MLAATLLSLGAVFLAELGDRSQLITMTYTLRYRWWVVLTGVAIAAFTVHGVAVAIGHFLG
STVPARPAACVSAIAFLIFAVWVWREDTASDSETSPTAAEPRLALFTVVSSFALAELGDK
TTLATVTLASDHHWAGVWIGTTLGMILADGLAIGAGLLLHRRLPERLLQVLTGLLFLLFG
LWLLFDDALGFRSVAIAVTAAVVLAAATTAVSVRVAQTRRRRPTAAATPEDDSTRPERSS
VAPGHPGSILLPLPEVSLRGRRPPSGSPDERCADPGSKGGSRRISVGCWLPGVGRIRPTR
SS