Protein Info for Rv3833 in Mycobacterium tuberculosis H37Rv

Annotation: Transcriptional regulatory protein (probably AraC-family)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 PF07883: Cupin_2" amino acids 14 to 74 (61 residues), 30.6 bits, see alignment E=4.4e-11 PF02311: AraC_binding" amino acids 18 to 97 (80 residues), 26.8 bits, see alignment E=7.9e-10 PF00165: HTH_AraC" amino acids 156 to 197 (42 residues), 30.1 bits, see alignment 8.5e-11 PF12833: HTH_18" amino acids 172 to 244 (73 residues), 77.9 bits, see alignment E=1.2e-25

Best Hits

KEGG orthology group: None (inferred from 100% identity to mtb:TBMG_03879)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (263 amino acids)

>Rv3833 Transcriptional regulatory protein (probably AraC-family) (Mycobacterium tuberculosis H37Rv)
MSENSHHRLATTSLTLPPGARIERHRHPSHQIVYPSAGAVSVTTHAGTWITPVNRAIWIP
AGCWHQHKFHGHTQFHGVALDPQRYRGGPATPTVLAVNPLMRELVIACSQADRTDTDEHH
RMLAVLQDQLPTTSIREPLWVPSPTDRRLRHACALIADNLTQPLTLQQIGGRIGVSQRTL
SRLFSDELGMTFPQWRTQLRLQHALVLLAERHDVTSVASECGWATPSAFIDTYRQAFGHT
PGQAAKPMAATRLTRLRRARDRR