Protein Info for Rv3822 in Mycobacterium tuberculosis H37Rv

Annotation: Conserved hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 404 PF08237: PE-PPE" amino acids 104 to 325 (222 residues), 241.3 bits, see alignment E=4.9e-76

Best Hits

Swiss-Prot: 100% identical to CHP1_MYCTU: SL1278 acyltransferase Chp1 (chp1) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mtc:MT3930)

MetaCyc: 100% identical to 3'-(hydroxy)phthioceranyl-2'-palmitoyl(stearoyl)-2-O-sulfo-trehalose (hydroxy)phthioceranyltransferase (Mycobacterium tuberculosis H37Rv)
RXN-17317 [EC: 2.3.1.284]; 2.3.1.284 [EC: 2.3.1.284]

Predicted SEED Role

No annotation

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.284

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (404 amino acids)

>Rv3822 Conserved hypothetical protein (Mycobacterium tuberculosis H37Rv)
MKCPGVSDCVATVRHDNVFAIAAGLRWSAAVPPLHKGDAVTKLLVGAIAGGMLACAAILG
DGIASADTALIVPGTAPSPYGPLRSLYHFNPAMQPQIGANYYNPTATRHVVSYPGSFWPV
TGLNSPTVGSSVSAGTNNLDAAIRSTDGPIFVAGLSQGTLVLDREQARLANDPTAPPPGQ
LTFIKAGDPNNLLWRAFRPGTHVPIIDYTVPAPAESQYDTINIVGQYDIFSDPPNRPGNL
LADLNAIAAGGYYGHSATAFSDPARVAPRDITTTTNSLGATTTTYFIRTDQLPLVRALVD
MAGLPPQAAGTVDAALRPIIDRAYQPGPAPAVNPRDLVQGIRGIPAIAPAIAIPIGSTTG
ASAATSTAAATAAATNALRGANVGPGANKALSMVRGLLPKGKKH