Protein Info for Rv3820c in Mycobacterium tuberculosis H37Rv

Annotation: Possible conserved polyketide synthase associated protein PapA2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 468 PF00668: Condensation" amino acids 70 to 362 (293 residues), 54.5 bits, see alignment E=4.2e-19

Best Hits

Swiss-Prot: 100% identical to PAPA2_MYCTO: Trehalose-2-sulfate acyltransferase papA2 (papA2) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: None (inferred from 100% identity to mbo:Mb3850c)

MetaCyc: 100% identical to 2-O-sulfo trehalose long-chain-acyltransferase (Mycobacterium tuberculosis H37Rv)
RXN-17318 [EC: 2.3.1.288]; 2.3.1.288 [EC: 2.3.1.288]

Predicted SEED Role

No annotation

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.288

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (468 amino acids)

>Rv3820c Possible conserved polyketide synthase associated protein PapA2 (Mycobacterium tuberculosis H37Rv)
VFSITTLRDWTPDPGSIICWHASPTAKAKARQAPISEVPPSYQQAQHLRRYRDHVARGLD
MSRLMIFTWDLPGRCNIRAMNYAINAHLRRHDTYHSWFEFDNAEHIVRHTIADPADIEVV
QAEHQNMTSAELRHHIATPQPLQWDCFLFGIIQSDDHFTFYASIAHLCVDPMIVGVLFIE
IHMMYSALVGGDPPIELPPAGRYDDHCVRQYADTAALTLDSARVRRWVEFAANNDGTLPH
FPLPLGDLSVPHTGKLLTETLMDEQQGERFEAACVAAGARFSGGVFACAALAERELTNCE
TFDVVTTTDTRRTPTELRTTGWFTGLVPITVPVASGLFDSAARVAQISFDSGKDLATVPF
DRVLELARPETGLRPPRPGNFVMSFLDASIAPLSTVANSDLNFRIYDEGRVSHQVSMWVN
RYQHQTTVTVLFPDNPIASESVANYIAAMKSIYIRTADGTLATLKPGT