Protein Info for Rv3813c in Mycobacterium tuberculosis H37Rv

Annotation: Conserved protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 TIGR01484: HAD hydrolase, family IIB" amino acids 8 to 241 (234 residues), 75.2 bits, see alignment E=7.7e-25 TIGR00099: Cof-like hydrolase" amino acids 8 to 268 (261 residues), 162 bits, see alignment E=2.1e-51 PF08282: Hydrolase_3" amino acids 9 to 268 (260 residues), 197.9 bits, see alignment E=5.2e-62 PF05116: S6PP" amino acids 170 to 257 (88 residues), 26.8 bits, see alignment E=7.7e-10

Best Hits

KEGG orthology group: K07024, (no description) (inferred from 99% identity to mbo:Mb3843c)

Predicted SEED Role

"Cof family hydrolase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (273 amino acids)

>Rv3813c Conserved protein (Mycobacterium tuberculosis H37Rv)
LKPTVPALVACDVDGTLLDDGETVTKRTRDAVHAAVDAGTHFILATGRPPRWVRPIVDAL
GFAPMAVCANGAVIYDPGTDRVMSVRTLPVDALATLAEVATRVIPGAGLAVERIGERAHD
TATPQFVSSPGYEHAWLNPDNTEVSIDHLLSAPAIKLLIRKAGAASADMAAELAKHVGFE
GDITYSTNNGLVEIVPLGISKATGVDEIARPLGISDAEVVAFGDMPNDVPMLLRAGLGVA
MGNAHPDALAVADEVTAPNSEDGVARVLERWWS