Protein Info for Rv3797 in Mycobacterium tuberculosis H37Rv

Annotation: Probable acyl-CoA dehydrogenase FadE35

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 593 PF18158: AidB_N" amino acids 33 to 187 (155 residues), 31.3 bits, see alignment E=4.3e-11 PF02770: Acyl-CoA_dh_M" amino acids 192 to 290 (99 residues), 60.5 bits, see alignment E=3e-20 PF00441: Acyl-CoA_dh_1" amino acids 309 to 461 (153 residues), 142.1 bits, see alignment E=3.1e-45 PF08028: Acyl-CoA_dh_2" amino acids 325 to 446 (122 residues), 51.8 bits, see alignment E=2.1e-17

Best Hits

KEGG orthology group: K00257, [EC: 1.3.99.-] (inferred from 100% identity to mbb:BCG_3859)

Predicted SEED Role

"Probable acyl-CoA dehydrogenase fadE35 (EC 1.3.99.-)" (EC 1.3.99.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.-

Use Curated BLAST to search for 1.3.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (593 amino acids)

>Rv3797 Probable acyl-CoA dehydrogenase FadE35 (Mycobacterium tuberculosis H37Rv)
MPEYDLEAVDKLPFSTPEKAQRYQTENYRGAMGLNWYLTDPTLQFIMAYYLRPDELAFAE
PHLTRIGELTGGPVTRWAEETDRNPPRLERYDRWGHDISRVVLPESFIQSKRAVIEARQA
VRDDAARAGVKPSLALFAADYLLNQADIGMACALATGGNMVRSLVTAYAPPDVREFVLGK
LNSGEWDGEAAQLLTERAGGSDLGALETTATRSGDVWLLNGFKWFASNCAGEAFVVLAKP
EGAPDSTRGVATFLVLRTRRDGSRNGVRIRRLKDKLGTRSVASGEIEFVDAEAFLLSGEP
SADAGPSDGKGLTRMMELTNRLRLGTASFALGNARRALVESLCYAGQRRAFGGALIDKPL
MRRKLAEMVVDVEAALAMVFDGFGAANHRQPRCLPQRIAVPVTKLKTCRLGITVASDAIE
IHGGNGYIETWPVARLLRDAQVNTIWEGPDNILCLDVRRGIEQTRAHETLLARLRDAVSV
SDDDDTTRLVSRRIEDLDAAITAWTKLDRQLAEARLFPLAQFMGDVYAGALLTEQAAWER
ATRGTDRKALVARLYARRYLADQGPLRGIDADCDEALQRFDELVAGAFTAEQT