Protein Info for Rv3791 in Mycobacterium tuberculosis H37Rv

Annotation: Decaprenylphosphoryl-D-2-keto erythro pentose reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 PF00106: adh_short" amino acids 10 to 203 (194 residues), 97.8 bits, see alignment E=8.7e-32 PF08659: KR" amino acids 11 to 171 (161 residues), 25.3 bits, see alignment E=2e-09 PF13561: adh_short_C2" amino acids 20 to 206 (187 residues), 70.5 bits, see alignment E=2.6e-23

Best Hits

Swiss-Prot: 100% identical to DPRE2_MYCTU: Decaprenylphosphoryl-2-keto-beta-D-erythro-pentose reductase (dprE2) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mbt:JTY_3855)

MetaCyc: 100% identical to decaprenyl-phosphoryl-2-keto-beta-D-erythro-pentofuranose reductase (Mycobacterium tuberculosis H37Rv)
RXN-11081 [EC: 1.1.1.333]

Predicted SEED Role

"3-oxoacyl-[acyl-carrier protein] reductase paralog (EC 1.1.1.100)" (EC 1.1.1.100)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100 or 1.1.1.333

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (254 amino acids)

>Rv3791 Decaprenylphosphoryl-D-2-keto erythro pentose reductase (Mycobacterium tuberculosis H37Rv)
MVLDAVGNPQTVLLLGGTSEIGLAICERYLHNSAARIVLACLPDDPRREDAAAAMKQAGA
RSVELIDFDALDTDSHPKMIEAAFSGGDVDVAIVAFGLLGDAEELWQNQRKAVQIAEINY
TAAVSVGVLLAEKMRAQGFGQIIAMSSAAGERVRRANFVYGSTKAGLDGFYLGLSEALRE
YGVRVLVIRPGQVRTRMSAHLKEAPLTVDKEYVANLAVTASAKGKELVWAPAAFRYVMMV
LRHIPRSIFRKLPI