Protein Info for Rv3778c in Mycobacterium tuberculosis H37Rv
Annotation: Possible aminotransferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to Y3778_MYCTO: Uncharacterized protein MT3887 (MT3887) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
KEGG orthology group: None (inferred from 100% identity to mra:MRA_3818)Predicted SEED Role
"Cysteine desulfurase (EC 2.8.1.7)" in subsystem Alanine biosynthesis (EC 2.8.1.7)
MetaCyc Pathways
- superpathway of thiamine diphosphate biosynthesis II (10/11 steps found)
- superpathway of L-alanine biosynthesis (4/4 steps found)
- thiazole component of thiamine diphosphate biosynthesis II (6/7 steps found)
- superpathway of thiamine diphosphate biosynthesis I (8/10 steps found)
- L-alanine biosynthesis III (1/1 steps found)
- L-cysteine degradation IV (1/1 steps found)
- thiazole component of thiamine diphosphate biosynthesis I (4/6 steps found)
- cytidylyl molybdenum cofactor sulfurylation (1/2 steps found)
- bis(guanylyl molybdopterin) cofactor sulfurylation (1/3 steps found)
- tRNA-uridine 2-thiolation (thermophilic bacteria) (2/5 steps found)
- tRNA-uridine 2-thiolation (mammalian mitochondria) (1/4 steps found)
- tRNA-uridine 2-thiolation (yeast mitochondria) (1/4 steps found)
- molybdopterin biosynthesis (2/6 steps found)
- tRNA-uridine 2-thiolation (cytoplasmic) (1/8 steps found)
- [2Fe-2S] iron-sulfur cluster biosynthesis (2/10 steps found)
- tRNA-uridine 2-thiolation and selenation (bacteria) (2/11 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 2.8.1.7
Use Curated BLAST to search for 2.8.1.7
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (398 amino acids)
>Rv3778c Possible aminotransferase (Mycobacterium tuberculosis H37Rv) MAYDVARVRGLHPSLGDGWVHFDAPAGMLIPDSVATTVSTAFRRSGASTVGAHPSARRSA AVLDAAREAVADLVNADPGGVVLGADRAVLLSLLAEASSSRAGLGYEVIVSRLDDEANIA PWLRAAHRYGAKVKWAEVDIETGELPTWQWESLISKSTRLVAVNSASGTLGGVTDLRAMT KLVHDVGALVVVDHSAAAPYRLLDIRETDADVVTVNAHAWGGPPIGAMVFRDPSVMNSFG SVSTNPYATGPARLEIGVHQFGLLAGVVASIEYLAALDESARGSRRERLAVSMQSADAYL NRVFDYLMVSLRSLPLVMLIGRPEAQIPVVSFAVHKVPADRVVQRLADNGILAIANTGSR VLDVLGVNDVGGAVTVGLAHYSTMAEVDQLVRALASLG