Protein Info for Rv3772 in Mycobacterium tuberculosis H37Rv

Annotation: Probable histidinol-phosphate aminotransferase HisC2 (imidazole acetol-phosphate transaminase) (imidazolylacetolphosphate aminotransferase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 353 PF00155: Aminotran_1_2" amino acids 25 to 338 (314 residues), 181.8 bits, see alignment E=1.1e-57

Best Hits

Swiss-Prot: 100% identical to PATR_MYCTU: Putative phenylalanine aminotransferase (pat) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K00817, histidinol-phosphate aminotransferase [EC: 2.6.1.9] (inferred from 99% identity to mbb:BCG_3833)

Predicted SEED Role

"Biosynthetic Aromatic amino acid aminotransferase beta (EC 2.6.1.57)" in subsystem Phenylalanine and Tyrosine Branches from Chorismate (EC 2.6.1.57)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.9

Use Curated BLAST to search for 2.6.1.57 or 2.6.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (353 amino acids)

>Rv3772 Probable histidinol-phosphate aminotransferase HisC2 (imidazole acetol-phosphate transaminase) (imidazolylacetolphosphate aminotransferase) (Mycobacterium tuberculosis H37Rv)
VTARLRPELAGLPVYVPGKTVPGAIKLASNETVFGPLPSVRAAIDRATDTVNRYPDNGCV
QLKAALARHLGPDFAPEHVAVGCGSVSLCQQLVQVTASVGDEVVFGWRSFELYPPQVRVA
GAIPIQVPLTDHTFDLYAMLATVTDRTRLIFVCNPNNPTSTVVGPDALARFVEAVPAHIL
IAIDEAYVEYIRDGMRPDSLGLVRAHNNVVVLRTFSKAYGLAGLRIGYAIGHPDVITALD
KVYVPFTVSSIGQAAAIASLDAADELLARTDTVVAERARVSAELRAAGFTLPPSQANFVW
LPLGSRTQDFVEQAADARIVVRPYGTDGVRVTVAAPEENDAFLRFARRWRSDQ