Protein Info for Rv3763 in Mycobacterium tuberculosis H37Rv

Annotation: 19 kDa lipoprotein antigen precursor LpqH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 159 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF05481: Myco_19_kDa" amino acids 48 to 158 (111 residues), 124.2 bits, see alignment E=1.7e-40

Best Hits

Swiss-Prot: 99% identical to LPQH_MYCBO: Lipoprotein LpqH (lpqH) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: K14953, ipoprotein LpqH (inferred from 99% identity to mtc:MT3870)

Predicted SEED Role

"19 kDa lipoprotein antigen precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (159 amino acids)

>Rv3763 19 kDa lipoprotein antigen precursor LpqH (Mycobacterium tuberculosis H37Rv)
VKRGLTVAVAGAAILVAGLSGCSSNKSTTGSGETTTAAGTTASPGAASGPKVVIDGKDQN
VTGSVVCTTAAGNVNIAIGGAATGIAAVLTDGNPPEVKSVGLGNVNGVTLGYTSGTGQGN
ASATKDGSHYKITGTATGVDMANPMSPVNKSFEIEVTCS