Protein Info for Rv3757c in Mycobacterium tuberculosis H37Rv

Annotation: Possible osmoprotectant (glycine betaine/carnitine/choline/L-proline) transport integral membrane protein ABC transporter ProW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 transmembrane" amino acids 17 to 40 (24 residues), see Phobius details amino acids 52 to 75 (24 residues), see Phobius details amino acids 81 to 100 (20 residues), see Phobius details amino acids 134 to 167 (34 residues), see Phobius details amino acids 179 to 201 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 33 to 203 (171 residues), 65.2 bits, see alignment E=3.4e-22

Best Hits

KEGG orthology group: K05846, osmoprotectant transport system permease protein (inferred from 100% identity to mtb:TBMG_03802)

Predicted SEED Role

"L-proline glycine betaine ABC transport system permease protein ProW (TC 3.A.1.12.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (TC 3.A.1.12.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (229 amino acids)

>Rv3757c Possible osmoprotectant (glycine betaine/carnitine/choline/L-proline) transport integral membrane protein ABC transporter ProW (Mycobacterium tuberculosis H37Rv)
MHYLMTHPGAAWALTVVHLRLSLLPVLIGLMSAVPLGLLVQRAPLLRRLTTATASVIFTI
PSLALFVVLPLIIGTRILDEANVIVALAAYTTALLVRAVLEALDAVPAQVHDAATAIGYS
RIAQMLKVELPLSIPVLVAGLRVVAVTNIAMVSVGSVIGIGGLGTWFTAGYQTNKSDQIV
AGVVAMFLLAIVVDVVINLAGRLATPWERAPRAARRRRQVAAPITGGAR