Protein Info for Rv3752c in Mycobacterium tuberculosis H37Rv

Annotation: Possible cytidine/deoxycytidylate deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00383: dCMP_cyt_deam_1
  • amino acids 2 to 102 (101 residues), 91.3 bits, E=3.3e-30
• PF14437: MafB19-deam
  • amino acids 9 to 150 (142 residues), 95 bits, E=3.9e-31

Best Hits

Swiss-Prot: 50% identical to TADA_STAAM: tRNA-specific adenosine deaminase (tadA) from Staphylococcus aureus (strain Mu50 / ATCC 700699)

KEGG orthology group: None (inferred from 99% identity to mbt:JTY_3813)

Predicted SEED Role

"tRNA-specific adenosine-34 deaminase (EC 3.5.4.-)" in subsystem tRNA processing (EC 3.5.4.-)

KEGG Metabolic Maps

• Atrazine degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.-

Protein Sequence (152 amino acids)

>Rv3752c Possible cytidine/deoxycytidylate deaminase (Mycobacterium tuberculosis H37Rv)
VTTDEDLIRAALAVAATAGPRDVPVGAVVVGADGTELARAVNAREALGDPTAHAEILAMR
LAAGVLGDGWRLEGTTLAVTVEPCTMCAGALVLARVARLVFGAWEPKTGAVGSLWDVVRD
RRLNHRPEVRGGVLARECAAPLEAFFARQRLG