Protein Info for Rv3752c in Mycobacterium tuberculosis H37Rv

Annotation: Possible cytidine/deoxycytidylate deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 152 PF00383: dCMP_cyt_deam_1" amino acids 2 to 102 (101 residues), 91.3 bits, see alignment E=3.3e-30 PF14437: MafB19-deam" amino acids 15 to 149 (135 residues), 90.8 bits, see alignment E=7.6e-30

Best Hits

Swiss-Prot: 50% identical to TADA_STAAM: tRNA-specific adenosine deaminase (tadA) from Staphylococcus aureus (strain Mu50 / ATCC 700699)

KEGG orthology group: None (inferred from 99% identity to mbt:JTY_3813)

Predicted SEED Role

"tRNA-specific adenosine-34 deaminase (EC 3.5.4.-)" in subsystem tRNA processing (EC 3.5.4.-)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (152 amino acids)

>Rv3752c Possible cytidine/deoxycytidylate deaminase (Mycobacterium tuberculosis H37Rv)
VTTDEDLIRAALAVAATAGPRDVPVGAVVVGADGTELARAVNAREALGDPTAHAEILAMR
LAAGVLGDGWRLEGTTLAVTVEPCTMCAGALVLARVARLVFGAWEPKTGAVGSLWDVVRD
RRLNHRPEVRGGVLARECAAPLEAFFARQRLG