Protein Info for Rv3750c in Mycobacterium tuberculosis H37Rv

Annotation: Possible excisionase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 130 PF12728: HTH_17" amino acids 55 to 103 (49 residues), 55.4 bits, see alignment E=3.1e-19 TIGR01764: DNA binding domain, excisionase family" amino acids 55 to 99 (45 residues), 62.1 bits, see alignment E=2.4e-21

Best Hits

Swiss-Prot: 100% identical to VPB50_MYCTU: Putative antitoxin VapB50 (vapB50) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mbb:BCG_3809c)

Predicted SEED Role

"PUTATIVE EXCISIONASE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (130 amino acids)

>Rv3750c Possible excisionase (Mycobacterium tuberculosis H37Rv)
MTSLLEVLGAPEVSVCGNAGQPMTLPEPVRDALYNVVLALSQGKGISLVPRHLKLTTQEA
ADLLNISRPTLVRLLEDGRIPFEKPGRHRRVSLDALLEYQQETRSNRRAALGELSRDALG
ELQAALAEKK