Protein Info for Rv3737 in Mycobacterium tuberculosis H37Rv

Annotation: Probable conserved transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 529 transmembrane" amino acids 161 to 188 (28 residues), see Phobius details amino acids 208 to 229 (22 residues), see Phobius details amino acids 235 to 253 (19 residues), see Phobius details amino acids 266 to 288 (23 residues), see Phobius details amino acids 314 to 334 (21 residues), see Phobius details amino acids 341 to 361 (21 residues), see Phobius details amino acids 367 to 385 (19 residues), see Phobius details amino acids 392 to 416 (25 residues), see Phobius details amino acids 428 to 449 (22 residues), see Phobius details PF06738: ThrE" amino acids 50 to 287 (238 residues), 210.4 bits, see alignment E=2.8e-66 PF12821: ThrE_2" amino acids 323 to 447 (125 residues), 49.3 bits, see alignment E=5.7e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to mtb:TBMG_03782)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (529 amino acids)

>Rv3737 Probable conserved transmembrane protein (Mycobacterium tuberculosis H37Rv)
MDQDRSDNTALRRGLRIALRGRRDPLPVAGRRSRTSGGIDDLHTRKVLDLTIRLAEVMLS
SGSGTADVVATAQDVAQAYQLTDCVVDITVTTIIVSALATTDTPPVTIMRSVRTRSTDYS
RLAELDRLVQRITSGGVAVDQAHEAMDELTERPHPYPRWLATAGAAGFALGVAMLLGGTW
LTCVLAAVTSGVIDRLGRLLNRIGTPLFFQRVFGAGIATLVAVAAYLIAGQDPTALVATG
IVVLLSGMTLVGSMQDAVTGYMLTALARLGDALFLTAGIVVGILISLRGVTNAGIQIELH
VDATTTLATPGMPLPILVAVSGAALSGVCLTIASYAPLRSVATAGLSAGLAELVLIGLGA
AGFGRVVATWTAAIGVGFLATLISIRRQAPALVTATAGIMPMLPGLAVFRAVFAFAVNDT
PDGGLTQLLEAAATALALGSGVVLGEFLASPLRYGAGRIGDLFRIEGPPGLRRAVGRVVR
LQPAKSQQPTGTGGQRWRSVALEPTTADDVDAGYRGDWPATCTSATEVR