Protein Info for Rv3729 in Mycobacterium tuberculosis H37Rv

Annotation: Possible transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 776 PF23545: Zn_ribbon_HMPTM" amino acids 2 to 45 (44 residues), 62 bits, see alignment 1.5e-20 PF04055: Radical_SAM" amino acids 95 to 259 (165 residues), 75.7 bits, see alignment E=2.5e-24 PF13353: Fer4_12" amino acids 99 to 183 (85 residues), 24.5 bits, see alignment E=1.5e-08 PF13489: Methyltransf_23" amino acids 554 to 707 (154 residues), 40.2 bits, see alignment E=1.5e-13 PF01209: Ubie_methyltran" amino acids 561 to 661 (101 residues), 36.1 bits, see alignment E=2.2e-12 PF13847: Methyltransf_31" amino acids 564 to 679 (116 residues), 55.5 bits, see alignment E=2.9e-18 PF13649: Methyltransf_25" amino acids 565 to 660 (96 residues), 70.2 bits, see alignment E=1e-22 PF08242: Methyltransf_12" amino acids 567 to 661 (95 residues), 41.9 bits, see alignment E=6.9e-14 PF08241: Methyltransf_11" amino acids 567 to 661 (95 residues), 68.8 bits, see alignment E=2.6e-22

Best Hits

KEGG orthology group: K06937, (no description) (inferred from 100% identity to mbo:Mb3756)

Predicted SEED Role

"Radical SAM protein required for addition of adenosine to hopane skeleton, HpnH"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (776 amino acids)

>Rv3729 Possible transferase (Mycobacterium tuberculosis H37Rv)
MFVEYTKSICPVCKVVVDAQVNIRHDKVYLRKRCREHGSFEALVYGDAQMYLESARFNKP
GTFPLRFQTEVRDGCPSDCGLCPDHKQHACLGLIEVNTHCNLDCPICFADSGHQPDGYAI
TAAQCERMLDTLVAAEGEPEVVMFSGGEPTIHKQLLEFVDAAQARPVKTVIINTNGIRLA
SDRRFVDQLATRNRPGHPVHIYLQFDGLDEATHRRIRGHDLRDVKQRALDNCAAAGLTVS
LVAAVERGLNEHELGAVIRHGMAQPGVQPVVFQPVTHAGRHVQFDPLTRLTNSDIIACIT
AQLPEWFRPGDFFPVPCCFPSCRSITYLLTDGEHVVPIPRLLNVEDYLDYVSNRVIPDLA
IREALENLWSASAVPGTDTMTAQLQRATAALNCAEGCGINLPEALTHLTDRVFAIVIQDF
QDPYTLNVKQLMKCCVQQITPDGRLIPFCAYNSVGYREQVREQLTGVPVPDIVPNAIPLA
GLLADAPHGSKQANTGGSIARLAGPTRGAPMALPPQQIKACCADAYSRDIVALLLGDSFH
PGGATLTRRLADQLGLRSTGDPRRVADIAAGPGASARLLASDYGVAVDGVDISEINVKRA
QAAVAQTGLTERVRFHLGDAESVPLPDDTFDALVCECAFCTFPDKNAAAQQFARILRPGG
LAGITDVTVGDGGLPAELTPLAAWVACIADARTVTDYTDILEGAGLRTRHIESHDESLLD
MIDRIDARITALHVAAPEILADNGIRHDSVRDFTALARAAVQTGRIGYTLMIAEKP