Protein Info for Rv3720 in Mycobacterium tuberculosis H37Rv

Annotation: Possible fatty acid synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 420 PF02353: CMAS" amino acids 130 to 398 (269 residues), 337.3 bits, see alignment E=1.7e-104 PF13489: Methyltransf_23" amino acids 182 to 302 (121 residues), 41 bits, see alignment E=4.1e-14 PF08241: Methyltransf_11" amino acids 196 to 291 (96 residues), 39.2 bits, see alignment E=2.2e-13 PF13649: Methyltransf_25" amino acids 196 to 289 (94 residues), 39.4 bits, see alignment E=2e-13

Best Hits

Swiss-Prot: 100% identical to FAMT_MYCTU: Probable fatty acid methyltransferase Rv3720 (Rv3720) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K00574, cyclopropane-fatty-acyl-phospholipid synthase [EC: 2.1.1.79] (inferred from 100% identity to mtb:TBMG_03764)

MetaCyc: 80% identical to oleate methyltransferase (methylene-forming) (Mycolicibacterium chlorophenolicum)
2.1.1.-

Predicted SEED Role

"Cyclopropane-fatty-acyl-phospholipid synthase (EC 2.1.1.79)" (EC 2.1.1.79)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.79

Use Curated BLAST to search for 2.1.1.79

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (420 amino acids)

>Rv3720 Possible fatty acid synthase (Mycobacterium tuberculosis H37Rv)
MAEILEIFTATGQHPLKFTAYDGSTAGQDDATLGLDLRTPRGATYLATAPGELGLARAYV
SGDLQAHGVHPGDPYELLKTLTERVDFKRPSARVLANVVRSIGVEHILPIAPPPQEARPR
WRRMANGLLHSKTRDAEAIHHHYDVSNNFYEWVLGPSMTYTCAVFPNAEASLEQAQENKY
RLIFEKLRLEPGDRLLDVGCGWGGMVRYAARRGVRVIGATLSAEQAKWGQKAVEDEGLSD
LAQVRHSDYRDVAETGFDAVSSIGLTEHIGVKNYPFYFGFLKSKLRTGGLLLNHCITRHD
NRSTSFAGGFTDRYVFPDGELTGSGRITTEIQQVGLEVLHEENFRHHYAMTLRDWCGNLV
EHWDDAVAEVGLPTAKVWGLYMAASRVAFERNNLQLHHVLATKVDPRGDDSLPLRPWWQP