Protein Info for Rv3709c in Mycobacterium tuberculosis H37Rv

Annotation: Aspartokinase Ask (aspartate kinase) [contains: aspartokinase alpha subunit (Ask-alpha); and aspartokinase beta subunit (Ask-beta)]

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00696: AA_kinase
  • amino acids 3 to 231 (229 residues), 188.2 bits, E=3e-59
• TIGR00657: aspartate kinase
  • amino acids 63 to 406 (344 residues), 403.9 bits, E=5.2e-125
• PF01842: ACT
  • amino acids 267 to 330 (64 residues), 42.6 bits, E=6.3e-15
• PF13840: ACT_7
  • amino acids 341 to 403 (63 residues), 53.5 bits, E=2.6e-18

Best Hits

Swiss-Prot: 100% identical to AK_MYCBO: Aspartokinase (ask) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: K00928, aspartate kinase [EC: 2.7.2.4] (inferred from 100% identity to mtb:TBMG_03753)

MetaCyc: 71% identical to aspartokinase beta subunit (Corynebacterium glutamicum ATCC 13032)
Aspartate kinase. [EC: 2.7.2.4]

Predicted SEED Role

"Aspartokinase (EC 2.7.2.4)" in subsystem Lysine Biosynthesis DAP Pathway or Threonine and Homoserine Biosynthesis (EC 2.7.2.4)

MetaCyc Pathways

• aspartate superpathway (23/25 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (16/18 steps found)
• L-lysine biosynthesis I (9/9 steps found)
• superpathway of L-methionine biosynthesis (by sulfhydrylation) (11/12 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• superpathway of L-threonine biosynthesis (6/6 steps found)
• L-lysine biosynthesis III (6/7 steps found)
• L-lysine biosynthesis VI (6/7 steps found)
• L-homoserine biosynthesis (3/3 steps found)
• L-lysine biosynthesis II (7/9 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (7/9 steps found)
• superpathway of L-methionine biosynthesis (transsulfuration) (7/9 steps found)
• superpathway of L-homoserine and L-methionine biosynthesis (6/8 steps found)
• dipicolinate biosynthesis (3/4 steps found)
• chorismate biosynthesis II (archaea) (8/12 steps found)
• L-methionine biosynthesis IV (2/4 steps found)
• spermidine biosynthesis II (2/4 steps found)
• ectoine biosynthesis (2/5 steps found)
• 3-dehydroquinate biosynthesis II (archaea) (3/7 steps found)
• norspermidine biosynthesis (2/6 steps found)
• cremeomycin biosynthesis (2/7 steps found)
• grixazone biosynthesis (2/8 steps found)
• superpathway of polyamine biosynthesis III (2/8 steps found)
• platensimycin biosynthesis (7/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of plant hormones
• Glycine, serine and threonine metabolism
• Lysine biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.2.4

Protein Sequence (421 amino acids)

>Rv3709c Aspartokinase Ask (aspartate kinase) [contains: aspartokinase alpha subunit (Ask-alpha); and aspartokinase beta subunit (Ask-beta)] (Mycobacterium tuberculosis H37Rv)
VALVVQKYGGSSVADAERIRRVAERIVATKKQGNDVVVVVSAMGDTTDDLLDLAQQVCPA
PPPRELDMLLTAGERISNALVAMAIESLGAHARSFTGSQAGVITTGTHGNAKIIDVTPGR
LQTALEEGRVVLVAGFQGVSQDTKDVTTLGRGGSDTTAVAMAAALGADVCEIYTDVDGIF
SADPRIVRNARKLDTVTFEEMLEMAACGAKVLMLRCVEYARRHNIPVHVRSSYSDRPGTV
VVGSIKDVPMEDPILTGVAHDRSEAKVTIVGLPDIPGYAAKVFRAVADADVNIDMVLQNV
SKVEDGKTDITFTCSRDVGPAAVEKLDSLRNEIGFSQLLYDDHIGKVSLIGAGMRSHPGV
TATFCEALAAVGVNIELISTSEIRISVLCRDTELDKAVVALHEAFGLGGDEEATVYAGTG
R