Protein Info for Rv3704c in Mycobacterium tuberculosis H37Rv

Annotation: Glutamate--cysteine ligase GshA (gamma-glutamylcysteine synthetase) (gamma-ECS) (GCS) (gamma-glutamyl-L-cysteine synthetase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 432 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details TIGR03444: ergothioneine biosynthesis glutamate--cysteine ligase EgtA" amino acids 32 to 410 (379 residues), 578.3 bits, see alignment E=3.6e-178 PF04107: GCS2" amino acids 45 to 425 (381 residues), 344.7 bits, see alignment E=4e-107

Best Hits

Swiss-Prot: 100% identical to EGTA_MYCTO: Glutamate--cysteine ligase EgtA (egtA) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K01919, glutamate--cysteine ligase [EC: 6.3.2.2] (inferred from 100% identity to mtf:TBFG_13735)

MetaCyc: 64% identical to glutamate--cysteine ligase (Mycolicibacterium smegmatis)
Glutamate--cysteine ligase. [EC: 6.3.2.2]

Predicted SEED Role

"Similar to Glutamate--cysteine ligase (EC 6.3.2.2), function unknown" (EC 6.3.2.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (432 amino acids)

>Rv3704c Glutamate--cysteine ligase GshA (gamma-glutamylcysteine synthetase) (gamma-ECS) (GCS) (gamma-glutamyl-L-cysteine synthetase) (Mycobacterium tuberculosis H37Rv)
MTLAAMTAAASQLDNAAPDDVEITDSSAAAEYIADGCLVDGPLGRVGLEMEAHCFDPADP
FRRPSWEEITEVLEWLSPLPGGSVVSVEPGGAVELSGPPADGVLAAIGAMTRDQAVLRSA
LANAGLGLVFLGADPLRSPVRVNPGARYRAMEQFFAASHSGVPGAAMMTSTAAIQVNLDA
GPQEGWAERVRLAHALGPTMIAIAANSPMLGGRFSGWQSTRQRVWGQMDSARCGPILGAS
GDHPGIDWAKYALKAPVMMVRSPDTQDTRAVTDYVPFTDWVDGRVLLDGRRATVADLVYH
LTTLFPPVRPRQWLEIRYLDSVPDEVWPAVVFTLVTLLDDPVAADLAVDAVEPVATAWDT
AARIGLADRRLYLAANRCLAIAARRVPTELIGAMQRLVDHVDRGVCPADDFSDRVIAGGI
ASAVTGMMHGAS