Protein Info for Rv3699 in Mycobacterium tuberculosis H37Rv

Annotation: Conserved protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF05724: TPMT
  • amino acids 22 to 186 (165 residues), 51.8 bits, E=2.6e-17
• PF13489: Methyltransf_23
  • amino acids 31 to 154 (124 residues), 34.5 bits, E=4.9e-12
• PF13847: Methyltransf_31
  • amino acids 45 to 169 (125 residues), 50.3 bits, E=6.8e-17
• PF13649: Methyltransf_25
  • amino acids 46 to 144 (99 residues), 57.9 bits, E=4e-19
• PF08241: Methyltransf_11
  • amino acids 47 to 148 (102 residues), 47.2 bits, E=8.8e-16
• PF08242: Methyltransf_12
  • amino acids 47 to 145 (99 residues), 41.5 bits, E=5.5e-14

Best Hits

Swiss-Prot: 55% identical to Y560_MYCTU: Uncharacterized protein Rv0560c (Rv0560c) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mtb:TBMG_03742)

MetaCyc: 55% identical to 2-heptyl-1-hydroxy-4(1H)-quinolinone methyltransferase (Mycobacterium tuberculosis H37Rv)
RXN-22019 [EC: 2.1.1.374]; 2.1.1.- [EC: 2.1.1.374]

Predicted SEED Role

"Methyltransferase (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.374

Protein Sequence (233 amino acids)

>Rv3699 Conserved protein (Mycobacterium tuberculosis H37Rv)
MTDEVMDWDSAYREQGAFEGPPPWNIGEPQPELATLIAAGKVRSDVLDAGCGYAELSLAL
AADGYTVVGIDLTPTAVAAATKAAEERGLTTASFVQADITEFAAYPAGSAGRFSTVIDST
LFHSLPVDSRDRYLSSVHRAAAPGASYYVLVFAKGAFPAELEVKPNEVDEDELRAAVSKY
WKIDEIRPAFIHVNPVTIPPQLAGAPVEFPPYDHDEKGRVKFPAYLLTAHKAG