Protein Info for Rv3679 in Mycobacterium tuberculosis H37Rv

Annotation: Probable anion transporter ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 PF02374: ArsA_ATPase" amino acids 22 to 181 (160 residues), 57.3 bits, see alignment E=2.3e-19 amino acids 198 to 247 (50 residues), 21.8 bits, see alignment 1.5e-08 PF01656: CbiA" amino acids 26 to 241 (216 residues), 31.9 bits, see alignment E=1.7e-11

Best Hits

Swiss-Prot: 100% identical to Y3679_MYCTU: Putative ATPase Rv3679 (Rv3679) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mbt:JTY_3739)

Predicted SEED Role

"Arsenical pump-driving ATPase (EC 3.6.3.16)" in subsystem Arsenic resistance (EC 3.6.3.16)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.16

Use Curated BLAST to search for 3.6.3.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (340 amino acids)

>Rv3679 Probable anion transporter ATPase (Mycobacterium tuberculosis H37Rv)
MVATTSSGGSSVGWPSRLSGVRLHLVTGKGGTGKSTIAAALALTLAAGGRKVLLVEVEGR
QGIAQLFDVPPLPYQELKIATAERGGQVNALAIDIEAAFLEYLDMFYNLGIAGRAMRRIG
AVEFATTIAPGLRDVLLTGKIKETVVRLDKNKLPVYDAIVVDAPPTGRIARFLDVTKAVS
DLAKGGPVHAQSEGVVKLLHSNQTAIHLVTLLEALPVQETLEAIEELAQMELPIGSVIVN
RNIPAHLEPQDLAKAAEGEVDADSVRAGLLTAGVKLPDADFAGLLTETIQHATRITARAE
IAQQLDALQVPRLELPTVSDGVDLGSLYELSESLAQQGVR