Protein Info for Rv3673c in Mycobacterium tuberculosis H37Rv

Annotation: Possible membrane-anchored thioredoxin-like protein (thiol-disulfide interchange related protein)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 227 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details PF08534: Redoxin" amino acids 98 to 206 (109 residues), 40.2 bits, see alignment E=4.5e-14 PF00578: AhpC-TSA" amino acids 102 to 206 (105 residues), 40.5 bits, see alignment E=3.9e-14 PF13905: Thioredoxin_8" amino acids 115 to 204 (90 residues), 30.3 bits, see alignment E=7.1e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to mbt:JTY_3732)

Predicted SEED Role

"Possible membrane-anchored thioredoxin-like protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (227 amino acids)

>Rv3673c Possible membrane-anchored thioredoxin-like protein (thiol-disulfide interchange related protein) (Mycobacterium tuberculosis H37Rv)
MPSLPTTPAETAMTTLTGKTRWTIAILAVVAALMAALVAQLHDYSASSTISQRPAPREHR
DGDTPEALAWSRQRANLPPCPAAGNGPGAAALRGVVVVCAGDGSAVDVARALAGRRVVIN
LWAHWCAPCMTELPVMAEYQRRVGPAVLVVTVHQGQNEAAALSRLADLGVRLPTLQDDRR
RVAAALRVANVMPATVVLRPDGSVAQTLPRAFGSADEIVAAVGNDAG