Protein Info for Rv3635 in Mycobacterium tuberculosis H37Rv

Annotation: Probable conserved transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 591 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 38 to 55 (18 residues), see Phobius details amino acids 63 to 82 (20 residues), see Phobius details amino acids 86 to 106 (21 residues), see Phobius details amino acids 113 to 135 (23 residues), see Phobius details amino acids 141 to 158 (18 residues), see Phobius details amino acids 170 to 196 (27 residues), see Phobius details amino acids 217 to 235 (19 residues), see Phobius details amino acids 247 to 265 (19 residues), see Phobius details amino acids 285 to 304 (20 residues), see Phobius details amino acids 311 to 330 (20 residues), see Phobius details amino acids 346 to 365 (20 residues), see Phobius details amino acids 380 to 403 (24 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to mtf:TBFG_13666)

Predicted SEED Role

"FIG00662132: possible membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (591 amino acids)

>Rv3635 Probable conserved transmembrane protein (Mycobacterium tuberculosis H37Rv)
MPAPRMPRVALVAVLLITVQLVVRVVLAFGGYFYWDDLILVGRAGTGGLLSPSYLFDDHD
GHVMPGAFLVAGAIIRVAPLVWTGPAISLVVLQLLESLALLRALYVISSWRPVLLIPLTF
ALFTPLAVPGFAWWAAALNSLPMLAALAWVCADAILLVRTGNHRYAVTGVLVYLGGLLFF
EKAAVIPFVSFAVAALQCHVRGDRSALATVWRAGVRLWTPSLALTVGWVALYLAVVDQRR
WSSDLSMTWDLLCRSVTHGIVPALAGGPWDWARWAPASPWATPPAVVMVLGWLVLIAVLA
LSLVRKRRIGPVWLTAAGYAVACQVPIFLMRSSPFTALELAQTLRYFPDLVVVLALLAAV
ALQAPNRAGTRWLDASPARAVATVASAVLFLTSSLYSTATFLASWRDNPTEGYLKNAQAS
LAAAASGAPLLDQEVDPLVLQRVAWPENLASHMFALLRVRPEFATTTTQLRMFTSTGRLV
DAKVTWVRTIIAGPVPQCGYFVQPDRPERLILDGPLLPGDWTVELNYLANSDGSMALALS
DGPERKVPVHPGLNRVYARLPGAGDAITVRANTTALSLCIGAAPVGFLAPA