Protein Info for Rv3632 in Mycobacterium tuberculosis H37Rv

Annotation: Possible conserved membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 114 transmembrane" amino acids 6 to 22 (17 residues), see Phobius details amino acids 30 to 48 (19 residues), see Phobius details amino acids 68 to 88 (21 residues), see Phobius details PF10066: DUF2304" amino acids 3 to 107 (105 residues), 106.8 bits, see alignment E=3.3e-35

Best Hits

KEGG orthology group: K09153, hypothetical protein (inferred from 100% identity to mtu:Rv3632)

Predicted SEED Role

"Possible membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (114 amino acids)

>Rv3632 Possible conserved membrane protein (Mycobacterium tuberculosis H37Rv)
MNWIQVLLIASIIGLLFYLLRSRRSARSRAWVKVGYVLFVLAGIYAVLRPDDTTVVANWF
GVRRGTDLMLYALVMAFSFTTLSTYMRFKDLELRYARIARALALEGAQAPEQCR