Protein Info for Rv3631 in Mycobacterium tuberculosis H37Rv

Annotation: Possible transferase (possibly glycosyltransferase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00535: Glycos_transf_2
  • amino acids 16 to 144 (129 residues), 92.1 bits, E=2e-30

Best Hits

KEGG orthology group: K01043, [EC: 2.-.-.-] (inferred from 100% identity to mbb:BCG_3689)

Predicted SEED Role

"Dolichol-phosphate mannosyltransferase (EC 2.4.1.83) in lipid-linked oligosaccharide synthesis cluster" (EC 2.4.1.83)

MetaCyc Pathways

• protein O-mannosylation II (mammals, core M1 and core M2) (1/5 steps found)
• protein O-mannosylation III (mammals, core M3) (1/5 steps found)
• protein O-mannosylation I (yeast) (1/8 steps found)
• protein N-glycosylation (Haloferax volcanii) (1/11 steps found)
• protein N-glycosylation initial phase (eukaryotic) (1/19 steps found)

KEGG Metabolic Maps

• Lipopolysaccharide biosynthesis
• N-Glycan biosynthesis
• Puromycin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.-.-.-, 2.4.1.83

Use Curated BLAST to search for 2.-.-.- or 2.4.1.83

Protein Sequence (241 amino acids)

>Rv3631 Possible transferase (possibly glycosyltransferase) (Mycobacterium tuberculosis H37Rv)
MASKMDTETHYSDVWVVIPAFNEAAVIGKVVTDVRSVFDHVVCVDDGSTDGTGDIARRSG
AHLVRHPINLGQGAAIQTGIEYARKQPGAQVFATFDGDGQHRVKDVAAMVDRLGAGDVDV
VIGTRFGRPVGKASASRPPLMKRIVLQTGARLSRRGRRLGLTDTNNGLRVFNKTVADGLN
ITMSGMSHATEFIMLIAENHWRVAEEPVEVLYTEYSKSKGQPLLNGVNIIFDGFLRGRMP
R