Protein Info for Rv3630 in Mycobacterium tuberculosis H37Rv

Annotation: Probable conserved integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 transmembrane" amino acids 34 to 55 (22 residues), see Phobius details amino acids 62 to 84 (23 residues), see Phobius details amino acids 111 to 131 (21 residues), see Phobius details amino acids 141 to 163 (23 residues), see Phobius details amino acids 172 to 193 (22 residues), see Phobius details amino acids 199 to 218 (20 residues), see Phobius details amino acids 239 to 261 (23 residues), see Phobius details amino acids 272 to 292 (21 residues), see Phobius details amino acids 312 to 337 (26 residues), see Phobius details amino acids 352 to 376 (25 residues), see Phobius details amino acids 383 to 402 (20 residues), see Phobius details amino acids 408 to 427 (20 residues), see Phobius details

Best Hits

Swiss-Prot: 100% identical to Y3630_MYCTU: Uncharacterized protein Rv3630 (Rv3630) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mbo:Mb3654)

Predicted SEED Role

"Possible membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (431 amino acids)

>Rv3630 Probable conserved integral membrane protein (Mycobacterium tuberculosis H37Rv)
LAVGAAAVTEVGDTASPVGSSGASGGAIASGSVARVGTAAAVTALCGYAVIYLAARNLAP
NGFSVFGVFWGAFGLVTGAANGLLQETTREVRSLGYLDVSADGRRTHPLRVSGMVGLGSL
VVIAGSSPLWSGRVFAEARWLSVALLSIGLAGFCLHATLLGMLAGTNRWTQYGALMVADA
VIRVVVAAATFVIGWQLVGFIWATVAGSVAWLIMLMTSPPTRAAARLMTPGATATFLRGA
AHSIIAAGASAILVMGFPVLLKLTSNELGAQGGVVILAVTLTRAPLLVPLTAMQGNLIAH
FVDERTERIRALIAPAALIGGVGAVGMLAAGVVGPWIMRVAFGSEYQSSSALLAWLTAAA
VAIAMLTLTGAAAVAAALHRAYSLGWVGATVGSGLLLLLPLSLETRTVVALLCGPLVGIG
VHLVALARTDE