Protein Info for Rv3625c in Mycobacterium tuberculosis H37Rv

Annotation: Possible cell cycle protein MesJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01171: ATP_bind_3
  • amino acids 28 to 193 (166 residues), 98.8 bits, E=3.2e-32
• TIGR02432: tRNA(Ile)-lysidine synthetase
  • amino acids 29 to 197 (169 residues), 113.3 bits, E=6.7e-37
• PF09179: TilS
  • amino acids 246 to 300 (55 residues), 42.1 bits, E=8.7e-15

Best Hits

Swiss-Prot: 100% identical to TILS_MYCTU: tRNA(Ile)-lysidine synthase (tilS) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K04075, tRNA(Ile)-lysidine synthase [EC: 6.3.4.-] (inferred from 100% identity to mra:MRA_3661)

Predicted SEED Role

"tRNA(Ile)-lysidine synthetase (EC 6.3.4.19)" (EC 6.3.4.19)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.- or 6.3.4.19

Protein Sequence (323 amino acids)

>Rv3625c Possible cell cycle protein MesJ (Mycobacterium tuberculosis H37Rv)
MDRQSAVAQLRAAAEQFARVHLDACDRWSVGLSGGPDSLALTAVAARLWPTTALIVDHGL
QPGSATVAETARIQAISLGCVDARVLCVQVGAAGGREAAARSARYSALEEHRDGPVLLAH
TLDDQAETVLLGLGRGSGARSIAGMRPYDPPWCRPLLGVRRSVTHAACRELGLTAWQDPH
NTDRRFTRTRLRTEVLPLLEDVLGGGVAEALARTATALREDTDLIDTIAAQALPGAAVAG
SRGQELSTSALTALPDAVRRRVIRGWLLAGGATGLTDRQIRGVDRLVTAWRGQGGVAVGS
TLRGQRLVAGRRDGVLVLRREPV