Protein Info for Rv3624c in Mycobacterium tuberculosis H37Rv
Annotation: Hypoxanthine-guanine phosphoribosyltransferase Hpt (HGPRT) (HGPRTase) (hypoxanthine phosphoribosyltransferase) (imp pyrophosphorylase) (imp diphosphorylase) (transphosphoribosyltransferase) (guanine phosphoribosyltransferase)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to HPRT_MYCTU: Hypoxanthine-guanine phosphoribosyltransferase (hpt) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
KEGG orthology group: K00760, hypoxanthine phosphoribosyltransferase [EC: 2.4.2.8] (inferred from 99% identity to mbb:BCG_3682c)Predicted SEED Role
No annotation
MetaCyc Pathways
- superpathway of purine nucleotide salvage (14/14 steps found)
- adenine and adenosine salvage III (4/4 steps found)
- guanine and guanosine salvage I (2/2 steps found)
- guanine and guanosine salvage II (2/2 steps found)
- adenine salvage (2/3 steps found)
- superpathway of guanine and guanosine salvage (2/3 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.4.2.8
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (216 amino acids)
>Rv3624c Hypoxanthine-guanine phosphoribosyltransferase Hpt (HGPRT) (HGPRTase) (hypoxanthine phosphoribosyltransferase) (imp pyrophosphorylase) (imp diphosphorylase) (transphosphoribosyltransferase) (guanine phosphoribosyltransferase) (Mycobacterium tuberculosis H37Rv) LTPALVVGPAAWHAVHVTQSSSAITPGQTAELYPGDIKSVLLTAEQIQARIAELGEQIGN DYRELSATTGQDLLLITVLKGAVLFVTDLARAIPVPTQFEFMAVSSYGSSTSSSGVVRIL KDLDRDIHGRDVLIVEDVVDSGLTLSWLSRNLTSRNPRSLRVCTLLRKPDAVHANVEIAY VGFDIPNDFVVGYGLDYDERYRDLSYIGTLDPRVYQ