Protein Info for Rv3624c in Mycobacterium tuberculosis H37Rv

Annotation: Hypoxanthine-guanine phosphoribosyltransferase Hpt (HGPRT) (HGPRTase) (hypoxanthine phosphoribosyltransferase) (imp pyrophosphorylase) (imp diphosphorylase) (transphosphoribosyltransferase) (guanine phosphoribosyltransferase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01203: hypoxanthine phosphoribosyltransferase
  • amino acids 40 to 210 (171 residues), 222.9 bits, E=1e-70
• PF00156: Pribosyltran
  • amino acids 48 to 197 (150 residues), 76.1 bits, E=9.7e-26

Best Hits

Swiss-Prot: 100% identical to HPRT_MYCTU: Hypoxanthine-guanine phosphoribosyltransferase (hpt) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K00760, hypoxanthine phosphoribosyltransferase [EC: 2.4.2.8] (inferred from 99% identity to mbb:BCG_3682c)

Predicted SEED Role

No annotation

MetaCyc Pathways

• superpathway of purine nucleotide salvage (14/14 steps found)
• adenine and adenosine salvage III (4/4 steps found)
• guanine and guanosine salvage I (2/2 steps found)
• guanine and guanosine salvage II (2/2 steps found)
• adenine salvage (2/3 steps found)
• superpathway of guanine and guanosine salvage (2/3 steps found)

KEGG Metabolic Maps

• Drug metabolism - other enzymes
• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.8

Protein Sequence (216 amino acids)

>Rv3624c Hypoxanthine-guanine phosphoribosyltransferase Hpt (HGPRT) (HGPRTase) (hypoxanthine phosphoribosyltransferase) (imp pyrophosphorylase) (imp diphosphorylase) (transphosphoribosyltransferase) (guanine phosphoribosyltransferase) (Mycobacterium tuberculosis H37Rv)
LTPALVVGPAAWHAVHVTQSSSAITPGQTAELYPGDIKSVLLTAEQIQARIAELGEQIGN
DYRELSATTGQDLLLITVLKGAVLFVTDLARAIPVPTQFEFMAVSSYGSSTSSSGVVRIL
KDLDRDIHGRDVLIVEDVVDSGLTLSWLSRNLTSRNPRSLRVCTLLRKPDAVHANVEIAY
VGFDIPNDFVVGYGLDYDERYRDLSYIGTLDPRVYQ