Protein Info for Rv3610c in Mycobacterium tuberculosis H37Rv

Annotation: Membrane-bound protease FtsH (cell division protein)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 760 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 115 to 132 (18 residues), see Phobius details PF06480: FtsH_ext" amino acids 11 to 105 (95 residues), 34.5 bits, see alignment E=4.9e-12 TIGR01241: ATP-dependent metallopeptidase HflB" amino acids 115 to 602 (488 residues), 762.6 bits, see alignment E=9.2e-234 PF07728: AAA_5" amino acids 198 to 318 (121 residues), 25.4 bits, see alignment E=3.1e-09 PF00004: AAA" amino acids 199 to 330 (132 residues), 161.3 bits, see alignment E=4.2e-51 PF17862: AAA_lid_3" amino acids 354 to 394 (41 residues), 41.2 bits, see alignment 2.4e-14 PF01434: Peptidase_M41" amino acids 412 to 601 (190 residues), 238.2 bits, see alignment E=1.7e-74

Best Hits

Swiss-Prot: 100% identical to FTSH_MYCTA: ATP-dependent zinc metalloprotease FtsH (ftsH) from Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)

KEGG orthology group: K03798, cell division protease FtsH [EC: 3.4.24.-] (inferred from 100% identity to mbo:Mb3640c)

Predicted SEED Role

"Cell division protein FtsH (EC 3.4.24.-)" in subsystem Bacterial Cell Division (EC 3.4.24.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (760 amino acids)

>Rv3610c Membrane-bound protease FtsH (cell division protein) (Mycobacterium tuberculosis H37Rv)
MNRKNVTRTITAIAVVVLLGWSFFYFSDDTRGYKPVDTSVAITQINGDNVKSAQIDDREQ
QLRLILKKGNNETDGSEKVITKYPTGYAVDLFNALSAKNAKVSTVVNQGSILGELLVYVL
PLLLLVGLFVMFSRMQGGARMGFGFGKSRAKQLSKDMPKTTFADVAGVDEAVEELYEIKD
FLQNPSRYQALGAKIPKGVLLYGPPGTGKTLLARAVAGEAGVPFFTISGSDFVEMFVGVG
ASRVRDLFEQAKQNSPCIIFVDEIDAVGRQRGAGLGGGHDEREQTLNQLLVEMDGFGDRA
GVILIAATNRPDILDPALLRPGRFDRQIPVSNPDLAGRRAVLRVHSKGKPMAADADLDGL
AKRTVGMTGADLANVINEAALLTARENGTVITGPALEEAVDRVIGGPRRKGRIISEQEKK
ITAYHEGGHTLAAWAMPDIEPIYKVTILARGRTGGHAVAVPEEDKGLRTRSEMIAQLVFA
MGGRAAEELVFREPTTGAVSDIEQATKIARSMVTEFGMSSKLGAVKYGSEHGDPFLGRTM
GTQPDYSHEVAREIDEEVRKLIEAAHTEAWEILTEYRDVLDTLAGELLEKETLHRPELES
IFADVEKRPRLTMFDDFGGRIPSDKPPIKTPGELAIERGEPWPQPVPEPAFKAAIAQATQ
AAEAARSDAGQTGHGANGSPAGTHRSGDRQYGSTQPDYGAPAGWHAPGWPPRSSHRPSYS
GEPAPTYPGQPYPTGQADPGSDESSAEQDDEVSRTKPAHG