Protein Info for Rv3605c in Mycobacterium tuberculosis H37Rv

Annotation: Probable conserved secreted protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 158 transmembrane" amino acids 9 to 28 (20 residues), see Phobius details amino acids 34 to 53 (20 residues), see Phobius details amino acids 87 to 107 (21 residues), see Phobius details amino acids 119 to 139 (21 residues), see Phobius details PF11377: DUF3180" amino acids 9 to 146 (138 residues), 131.4 bits, see alignment E=1.3e-42

Best Hits

KEGG orthology group: None (inferred from 99% identity to mtc:MT3710)

Predicted SEED Role

"FIG027937: secreted protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (158 amino acids)

>Rv3605c Probable conserved secreted protein (Mycobacterium tuberculosis H37Rv)
MGPTRKRDLTAAVVGAAAVGYLLVAVLYRWFPPITVWTGLSLLAVAVAEALWARYVRVKI
SDGEIGDGPGWLHPLVVARSLMVAKASAWVGALVTGWWIGVLAYFLPRRSWLRAAAEDTT
GTVVAAGSALALVVAALWLQHCCKSPQDPTEHADGAES