Protein Info for Rv3601c in Mycobacterium tuberculosis H37Rv

Annotation: Probable aspartate 1-decarboxylase precursor PanD (aspartate alpha-decarboxylase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 139 TIGR00223: aspartate 1-decarboxylase" amino acids 1 to 118 (118 residues), 165.3 bits, see alignment E=2.9e-53 PF02261: Asp_decarbox" amino acids 1 to 113 (113 residues), 169 bits, see alignment E=1.6e-54

Best Hits

Swiss-Prot: 100% identical to PAND_MYCBP: Aspartate 1-decarboxylase (panD) from Mycobacterium bovis (strain BCG / Pasteur 1173P2)

KEGG orthology group: K01579, aspartate 1-decarboxylase [EC: 4.1.1.11] (inferred from 100% identity to mra:MRA_3640)

MetaCyc: 50% identical to aspartate 1-decarboxylase proenzyme (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Aspartate 1-decarboxylase (EC 4.1.1.11)" in subsystem Coenzyme A Biosynthesis (EC 4.1.1.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (139 amino acids)

>Rv3601c Probable aspartate 1-decarboxylase precursor PanD (aspartate alpha-decarboxylase) (Mycobacterium tuberculosis H37Rv)
MLRTMLKSKIHRATVTCADLHYVGSVTIDADLMDAADLLEGEQVTIVDIDNGARLVTYAI
TGERGSGVIGINGAAAHLVHPGDLVILIAYATMDDARARTYQPRIVFVDAYNKPIDMGHD
PAFVPENAGELLDPRLGVG