Protein Info for Rv3593 in Mycobacterium tuberculosis H37Rv

Annotation: Probable conserved lipoprotein LpqF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details PF18042: ORF_12_N" amino acids 51 to 138 (88 residues), 67.2 bits, see alignment E=1.4e-22 PF13354: Beta-lactamase2" amino acids 154 to 284 (131 residues), 84.2 bits, see alignment E=8.4e-28

Best Hits

KEGG orthology group: None (inferred from 99% identity to mbb:BCG_3658)

Predicted SEED Role

"Beta-lactamase (EC 3.5.2.6)" in subsystem Beta-lactamase or Tn552 (EC 3.5.2.6)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.2.6

Use Curated BLAST to search for 3.5.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (452 amino acids)

>Rv3593 Probable conserved lipoprotein LpqF (Mycobacterium tuberculosis H37Rv)
VGPARLHNRRAGRRMLALSAAAALIVALASGCSSAPTPSANAANHGHRIDTRTPPGLRAQ
QTMDMLNSDWPIGEIGVGTLAAPGQVDTVKTTMEALWWDRPFALAGVDIGASVAALHLIS
SYGAQQDIRIHTDDDGWVDRFDVETQAPSIASWRDVDAALSKTGARYSFQVAKVDNGRCD
PVAGTNTGESLPLASIFKLYVLHALAGAVQHNTVSWDDLLTVTAKSKAVGSSGLELPVGA
RVSVRTAAEKMIATSDNMATDLLIERLGTRAIEEALASAGHHDPASMTPFPTMYELFSVG
WGKPDLRDQWKHATQQVRAQILRQTNSTPYQPDPTRAHTPASNYGAEWYGSAEDICRVHA
ALRADAVGPASPVRQIMSAVPGIQLDRSVWPYIGAKAGGLPGDLTFSWYAVDKTGQPWVV
SFQLNWPRDHGPTVTGWMLQVARQVFALIAPQ