Protein Info for Rv3589 in Mycobacterium tuberculosis H37Rv

Annotation: Probable adenine glycosylase MutY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00730: HhH-GPD
  • amino acids 46 to 159 (114 residues), 60.9 bits, E=1.4e-20
• PF00633: HHH
  • amino acids 111 to 139 (29 residues), 29.5 bits, see alignment (E = 4.5e-11)

Best Hits

Swiss-Prot: 100% identical to MUTY_MYCTU: Adenine DNA glycosylase (mutY) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K03575, A/G-specific adenine glycosylase [EC: 3.2.2.-] (inferred from 100% identity to mtb:TBMG_03628)

Predicted SEED Role

"A/G-specific adenine glycosylase (EC 3.2.2.-)" in subsystem DNA repair, bacterial (EC 3.2.2.-)

Isozymes

Compare fitness of predicted isozymes for: 3.2.2.-

Use Curated BLAST to search for 3.2.2.-

Protein Sequence (304 amino acids)

>Rv3589 Probable adenine glycosylase MutY (Mycobacterium tuberculosis H37Rv)
MPHILPEPSVTGPRHISDTNLLAWYQRSHRDLPWREPGVSPWQILVSEFMLQQTPAARVL
AIWPDWVRRWPTPSATATASTADVLRAWGKLGYPRRAKRLHECATVIARDHNDVVPDDIE
ILVTLPGVGSYTARAVACFAYRQRVPVVDTNVRRVVARAVHGRADAGAPSVPRDHADVLA
LLPHRETAPEFSVALMELGATVCTARTPRCGLCPLDWCAWRHAGYPPSDGPPRRGQAYTG
TDRQVRGRLLDVLRAAEFPVTRAELDVAWLTDTAQRDRALESLLADALVTRTVDGRFALP
GEGF