Protein Info for Rv3579c in Mycobacterium tuberculosis H37Rv

Annotation: Possible tRNA/rRNA methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00186: RNA methyltransferase, TrmH family, group 3
  • amino acids 67 to 307 (241 residues), 188.7 bits, E=5.9e-60
• PF08032: SpoU_sub_bind
  • amino acids 70 to 145 (76 residues), 56.2 bits, E=3.6e-19
• PF00588: SpoU_methylase
  • amino acids 161 to 300 (140 residues), 130.2 bits, E=6.5e-42

Best Hits

Swiss-Prot: 100% identical to Y3618_MYCTA: Uncharacterized tRNA/rRNA methyltransferase MRA_3618 (MRA_3618) from Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)

KEGG orthology group: K03218, RNA methyltransferase, TrmH family [EC: 2.1.1.-] (inferred from 100% identity to mbb:BCG_3644c)

Predicted SEED Role

"23S rRNA (guanosine-2'-O-) -methyltransferase rlmB (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Protein Sequence (322 amino acids)

>Rv3579c Possible tRNA/rRNA methyltransferase (Mycobacterium tuberculosis H37Rv)
MPGNSRRRGAVRKSGTKKGAGVGSGGQRRRGLEGRGPTPPAHLRPHHPAAKRARAQPRRP
VKRADETETVLGRNPVLECLRAGVPATALYVALGTEADERLTECVARAADSGIAIVELLR
ADLDRMTANHLHQGIALQVPPYNYAHPDDLLAAALDQPPALLVALDNLSDPRNLGAIVRS
VAAFGGHGVLIPQRRSASVTAVAWRTSAGAAARIPVARATNLTRTLKGWADRGVRVIGLD
AGGGTALDDVDGTDSLVVVVGSEGKGLSRLVRQNCDEVVSIPMAAQAESLNASVAAGVVL
AEIARQRRRPREPREQTQNRMI