Protein Info for Rv3578 in Mycobacterium tuberculosis H37Rv

Annotation: Possible arsenical pump integral membrane protein ArsB2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 413 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 29 to 45 (17 residues), see Phobius details amino acids 52 to 71 (20 residues), see Phobius details amino acids 100 to 125 (26 residues), see Phobius details amino acids 137 to 155 (19 residues), see Phobius details amino acids 174 to 195 (22 residues), see Phobius details amino acids 215 to 233 (19 residues), see Phobius details amino acids 239 to 256 (18 residues), see Phobius details amino acids 269 to 290 (22 residues), see Phobius details amino acids 305 to 324 (20 residues), see Phobius details amino acids 331 to 352 (22 residues), see Phobius details amino acids 385 to 408 (24 residues), see Phobius details PF02040: ArsB" amino acids 3 to 399 (397 residues), 83.7 bits, see alignment E=1.8e-27 PF03600: CitMHS" amino acids 24 to 343 (320 residues), 116.2 bits, see alignment E=1.7e-37

Best Hits

KEGG orthology group: None (inferred from 100% identity to mbo:Mb3609)

Predicted SEED Role

"Arsenic efflux pump protein" in subsystem Arsenic resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (413 amino acids)

>Rv3578 Possible arsenical pump integral membrane protein ArsB2 (Mycobacterium tuberculosis H37Rv)
LTLAVALILLAVVLGFAVARPRGWPEAAAAVPAAVILLAIGAISPQQAMAQVSGLARVVA
FLGAVLVLAKLCDDEGLFEAAGAAMARASAESHRLLRQVFAVSAAITAALCLDATVVLLT
PVVLATVRRLRTPVRPYAYATAHLANAASLLLPVSNLTNLLAYHGAGISFTKFTLLMALP
WLSAVAAVYVVFRWFFARDLRVVPDRQQLKPAPRLPMFVLVVVALTLGGFAVAESVGLAP
TWAALAGAAVLALRSLRRGHTSVLRIARAVNVSFLVFVLALGVVVHAVMLNGMAARMSAV
LPTGSGLPALLGIAALAAVLANVVNNLPATLVLVPLVAAGGPAAVLAVLLGVNIGPNLTY
AGSLSNLLWRGVLRRHNVDASVGEYTRLGLCTVPAALAMAVLALWASAQVLGI