Protein Info for Rv3571 in Mycobacterium tuberculosis H37Rv

Annotation: Reductase component of 3-ketosteroid-9-alpha-hydroxylase KshB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 PF00970: FAD_binding_6" amino acids 47 to 121 (75 residues), 33.4 bits, see alignment E=7.2e-12 PF00175: NAD_binding_1" amino acids 132 to 229 (98 residues), 48 bits, see alignment E=2.8e-16 PF00111: Fer2" amino acids 274 to 348 (75 residues), 59.4 bits, see alignment E=3.9e-20

Best Hits

Swiss-Prot: 100% identical to KSHB_MYCTU: 3-ketosteroid-9-alpha-monooxygenase, ferredoxin reductase component (hmp) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mtf:TBFG_13604)

MetaCyc: 100% identical to NADH-ferredoxin reductase (Mycobacterium tuberculosis H37Rv)
Ferredoxin--NAD(+) reductase. [EC: 1.18.1.3]

Predicted SEED Role

"Phenylacetate-CoA oxygenase/reductase, PaaK subunit"

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.18.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (358 amino acids)

>Rv3571 Reductase component of 3-ketosteroid-9-alpha-hydroxylase KshB (Mycobacterium tuberculosis H37Rv)
LTEAIGDEPLGDHVLELQIAEVVDETDEARSLVFAVPDGSDDPEIPPRRLRYAPGQFLTL
RVPSERTGSVARCYSLCSSPYTDDALAVTVKRTADGYASNWLCDHAQVGMRIHVLAPSGN
FVPTTLDADFLLLAAGSGITPIMSICKSALAEGGGQVTLLYANRDDRSVIFGDALRELAA
KYPDRLTVLHWLESLQGLPSASALAKLVAPYTDRPVFICGPGPFMQAARDALAALKVPAQ
QVHIEVFKSLESDPFAAVKVDDSGDEAPATAVVELDGQTHTVSWPRTAKLLDVLLAAGLD
APFSCREGHCGACACTLRAGKVNMGVNDVLEQQDLDEGLILACQSRPESDSVEVTYDE