Protein Info for Rv3569c in Mycobacterium tuberculosis H37Rv

Annotation: 4,9-DHSA hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF12146: Hydrolase_4
  • amino acids 36 to 274 (239 residues), 55.1 bits, E=1e-18
• PF00561: Abhydrolase_1
  • amino acids 38 to 275 (238 residues), 99.6 bits, E=3.4e-32
• PF12697: Abhydrolase_6
  • amino acids 39 to 280 (242 residues), 77.4 bits, E=4e-25

Best Hits

Swiss-Prot: 100% identical to HSAD_MYCTO: 4,5:9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase (hsaD) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K05714, 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [EC: 3.7.1.-] (inferred from 100% identity to mtc:MT3674)

MetaCyc: 100% identical to 4,5-9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase monomer (Mycobacterium tuberculosis H37Rv)
RXN-12718 [EC: 3.7.1.17]

Predicted SEED Role

"2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (EC 3.7.1.-)" in subsystem Biphenyl Degradation or Central meta-cleavage pathway of aromatic compound degradation or carbazol degradation cluster (EC 3.7.1.-)

MetaCyc Pathways

• androstenedione degradation I (aerobic) (22/25 steps found)
• superpathway of cholesterol degradation I (cholesterol oxidase) (34/42 steps found)
• superpathway of cholesterol degradation II (cholesterol dehydrogenase) (36/47 steps found)
• superpathway of testosterone and androsterone degradation (22/28 steps found)

KEGG Metabolic Maps

• 1,1,1-Trichloro-2,2-bis(4-chlorophenyl)ethane (DDT) degradation
• Ascorbate and aldarate metabolism
• Benzoate degradation via CoA ligation
• Benzoate degradation via hydroxylation
• Biphenyl degradation
• Caprolactam degradation
• Ethylbenzene degradation
• Inositol phosphate metabolism
• Limonene and pinene degradation
• Nicotinate and nicotinamide metabolism
• Phenylalanine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.7.1.- or 3.7.1.17

Protein Sequence (291 amino acids)

>Rv3569c 4,9-DHSA hydrolase (Mycobacterium tuberculosis H37Rv)
MTATEELTFESTSRFAEVDVDGPLKLHYHEAGVGNDQTVVLLHGGGPGAASWTNFSRNIA
VLARHFHVLAVDQPGYGHSDKRAEHGQFNRYAAMALKGLFDQLGLGRVPLVGNSLGGGTA
VRFALDYPARAGRLVLMGPGGLSINLFAPDPTEGVKRLSKFSVAPTRENLEAFLRVMVYD
KNLITPELVDQRFALASTPESLTATRAMGKSFAGADFEAGMMWREVYRLRQPVLLIWGRE
DRVNPLDGALVALKTIPRAQLHVFGQCGHWVQVEKFDEFNKLTIEFLGGGR