Protein Info for Rv3564 in Mycobacterium tuberculosis H37Rv

Annotation: Probable acyl-CoA dehydrogenase FadE33

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02771: Acyl-CoA_dh_N
  • amino acids 5 to 99 (95 residues), 47.5 bits, E=3.2e-16
• PF00441: Acyl-CoA_dh_1
  • amino acids 185 to 294 (110 residues), 78.7 bits, E=7.9e-26
• PF08028: Acyl-CoA_dh_2
  • amino acids 187 to 281 (95 residues), 34.5 bits, E=3.6e-12

Best Hits

KEGG orthology group: K00257, [EC: 1.3.99.-] (inferred from 100% identity to mtf:TBFG_13597)

Predicted SEED Role

"Butyryl-CoA dehydrogenase (EC 1.3.99.2)" in subsystem Acetyl-CoA fermentation to Butyrate or Anaerobic respiratory reductases or Butanol Biosynthesis or Isobutyryl-CoA to Propionyl-CoA Module or Isoleucine degradation or Valine degradation (EC 1.3.99.2)

MetaCyc Pathways

• pyruvate fermentation to butanol II (engineered) (4/6 steps found)
• pyruvate fermentation to hexanol (engineered) (7/11 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (17/27 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Brassinosteroid biosynthesis
• Butanoate metabolism
• Caprolactam degradation
• Fatty acid metabolism
• Geraniol degradation
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.-, 1.3.99.2

Use Curated BLAST to search for 1.3.99.- or 1.3.99.2

Protein Sequence (318 amino acids)

>Rv3564 Probable acyl-CoA dehydrogenase FadE33 (Mycobacterium tuberculosis H37Rv)
MTPPEERQMLRETVASLVAKHAGPAAVRAAMASDRGYDESLWRLLCEQVGAAALVIPEEL
GGAGGELADAAIVVQELGRALVPSPLLGTTLAELALLAAAKPDAQALTELAQGSAIGALV
LDPDYVVNGDIADIVVAATSGQLTRWTRFSAQPVATMDPTRRLARLQSEETEPLCPDPGI
ADTAAILLAAEQIGAAERCLQLTVEYAKSRVQFGRPIGSFQALKHRMADLYVTIAAARAV
VADACHAPTPTNAATARLAASEALSTAAAEGIQLHGGIAITWEHDMHLYFKRAHGSAQLL
ESPREVLRRLESEVWESP