Protein Info for Rv3559c in Mycobacterium tuberculosis H37Rv
Annotation: Probable oxidoreductase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K00059, 3-oxoacyl-[acyl-carrier protein] reductase [EC: 1.1.1.100] (inferred from 100% identity to mbt:JTY_3624)MetaCyc: 100% identical to 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl-CoA reductase (Mycobacterium tuberculosis H37Rv)
3-beta-hydroxy-Delta(5)-steroid dehydrogenase. [EC: 1.1.1.145]; 1.1.1.- [EC: 1.1.1.145]
Predicted SEED Role
"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)
MetaCyc Pathways
- mycolate biosynthesis (165/205 steps found)
- androstenedione degradation I (aerobic) (22/25 steps found)
- superpathway of cholesterol degradation I (cholesterol oxidase) (34/42 steps found)
- superpathway of fatty acid biosynthesis II (plant) (34/43 steps found)
- superpathway of cholesterol degradation II (cholesterol dehydrogenase) (36/47 steps found)
- superpathway of testosterone and androsterone degradation (22/28 steps found)
- palmitate biosynthesis II (type II fatty acid synthase) (24/31 steps found)
- biotin biosynthesis I (12/15 steps found)
- superpathway of fatty acids biosynthesis (E. coli) (39/53 steps found)
- stearate biosynthesis II (bacteria and plants) (5/6 steps found)
- progesterone biosynthesis (2/2 steps found)
- gondoate biosynthesis (anaerobic) (3/4 steps found)
- 8-amino-7-oxononanoate biosynthesis I (8/11 steps found)
- stearate biosynthesis IV (4/6 steps found)
- palmitoleate biosynthesis I (from (5Z)-dodec-5-enoate) (6/9 steps found)
- superpathway of fatty acid biosynthesis I (E. coli) (11/16 steps found)
- 8-amino-7-oxononanoate biosynthesis IV (3/5 steps found)
- cis-vaccenate biosynthesis (3/5 steps found)
- fatty acid elongation -- saturated (3/5 steps found)
- oleate biosynthesis IV (anaerobic) (9/14 steps found)
- (5Z)-dodecenoate biosynthesis I (3/6 steps found)
- (5Z)-dodecenoate biosynthesis II (3/6 steps found)
- cholesterol degradation to androstenedione II (cholesterol dehydrogenase) (14/22 steps found)
- androgen biosynthesis (2/6 steps found)
- petroselinate biosynthesis (2/6 steps found)
- superpathway of unsaturated fatty acids biosynthesis (E. coli) (12/20 steps found)
- octanoyl-[acyl-carrier protein] biosynthesis (mitochondria, yeast) (6/12 steps found)
- backdoor pathway of androgen biosynthesis (4/11 steps found)
- 2-allylmalonyl-CoA biosynthesis (1/8 steps found)
- palmitate biosynthesis III (16/29 steps found)
- superpathway of mycolate biosynthesis (166/239 steps found)
- sitosterol degradation to androstenedione (8/18 steps found)
- cholesterol degradation to androstenedione III (anaerobic) (10/22 steps found)
- tetradecanoate biosynthesis (mitochondria) (12/25 steps found)
- androstenedione degradation II (anaerobic) (13/27 steps found)
- anteiso-branched-chain fatty acid biosynthesis (18/34 steps found)
- even iso-branched-chain fatty acid biosynthesis (18/34 steps found)
- odd iso-branched-chain fatty acid biosynthesis (18/34 steps found)
- streptorubin B biosynthesis (15/34 steps found)
- 11-oxyandrogens biosynthesis (4/20 steps found)
- superpathway of cholesterol degradation III (oxidase) (23/49 steps found)
- superpathway of steroid hormone biosynthesis (4/28 steps found)
KEGG Metabolic Maps
- Androgen and estrogen metabolism
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- Biosynthesis of unsaturated fatty acids
- C21-Steroid hormone metabolism
- Fatty acid biosynthesis
Isozymes
Compare fitness of predicted isozymes for: 1.1.1.100, 1.1.1.145
Use Curated BLAST to search for 1.1.1.100 or 1.1.1.145
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (262 amino acids)
>Rv3559c Probable oxidoreductase (Mycobacterium tuberculosis H37Rv) MNLSVAPKEIAGHGLLDGKVVVVTAAAGTGIGSATARRALAEGADVVISDHHERRLGETA AELSALGLGRVEHVVCDVTSTAQVDALIDSTTARMGRLDVLVNNAGLGGQTPVADMTDDE WDRVLDVSLTSVFRATRAALRYFRDAPHGGVIVNNASVLGWRAQHSQSHYAAAKAGVMAL TRCSAIEAAEYGVRINAVSPSIARHKFLDKTASAELLDRLAAGEAFGRAAEPWEVAATIA FLASDYSSYLTGEVISVSCQHP