Protein Info for Rv3557c in Mycobacterium tuberculosis H37Rv

Annotation: Transcriptional regulatory protein (probably TetR-family)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 PF00440: TetR_N" amino acids 15 to 61 (47 residues), 62.5 bits, see alignment 2.5e-21 PF17932: TetR_C_24" amino acids 81 to 195 (115 residues), 70.7 bits, see alignment E=1.3e-23

Best Hits

Swiss-Prot: 100% identical to KSTR2_MYCTO: HTH-type transcriptional repressor KstR2 (kstR2) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: None (inferred from 100% identity to mbo:Mb3587c)

Predicted SEED Role

"Transcriptional factor in putative operon for degradation of branched-chain alkanes, nitroalkanes and may be also cyclic ketones, alkenoic acids"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (200 amino acids)

>Rv3557c Transcriptional regulatory protein (probably TetR-family) (Mycobacterium tuberculosis H37Rv)
MDRVAGQVNSRRGELLELAAAMFAERGLRATTVRDIADGAGILSGSLYHHFASKEEMVDE
LLRGFLDWLFARYRDIVDSTANPLERLQGLFMASFEAIEHHHAQVVIYQDEAQRLASQPR
FSYIEDRNKQQRKMWVDVLNQGIEEGYFRPDLDVDLVYRFIRDTTWVSVRWYRPGGPLTA
QQVGQQYLAIVLGGITKEGV