Protein Info for Rv3552 in Mycobacterium tuberculosis H37Rv

Annotation: Possible CoA-transferase (beta subunit)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

No protein families (PFam or TIGRFam), signal peptides, or transmembrane helices were found in this protein.

Best Hits

Swiss-Prot: 100% identical to Y3552_MYCTU: Putative CoA-transferase subunit beta Rv3552 (Rv3552) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K01041, [EC: 2.8.3.-] (inferred from 100% identity to mbt:JTY_3617)

MetaCyc: 100% identical to 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl-CoA ligase beta subunit (Mycobacterium tuberculosis H37Rv)
4.1.99.-

Predicted SEED Role

"Putative CoA-transferase subunit beta Rv3552/MT3656 (EC 2.8.3.-)" (EC 2.8.3.-)

MetaCyc Pathways

androstenedione degradation I (aerobic) (22/25 steps found)
superpathway of cholesterol degradation I (cholesterol oxidase) (34/42 steps found)
superpathway of cholesterol degradation II (cholesterol dehydrogenase) (36/47 steps found)
superpathway of testosterone and androsterone degradation (22/28 steps found)
androstenedione degradation II (anaerobic) (13/27 steps found)
superpathway of cholesterol degradation III (oxidase) (23/49 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.8.3.-

Use Curated BLAST to search for 2.8.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (250 amino acids)

>Rv3552 Possible CoA-transferase (beta subunit) (Mycobacterium tuberculosis H37Rv)
VSTRAEVCAVACAELFRDAGEIMISPMTNMASVGARLARLTFAPDILLTDGEAQLLADTP
ALGKTGAPNRIEGWMPFGRVFETLAWGRRHVVMGANQVDRYGNQNISAFGPLQRPTRQMF
GVRGSPGNTINHATSYWVGNHCKRVFVEAVDVVSGIGYDKVDPDNPAFRFVNVYRVVSNL
GVFDFGGPDHSMRAVSLHPGVTPGDVRDATSFEVHDLDAAEQTRLPTDDELHLIRAVIDP
KSLRDREIRS