Protein Info for Rv3535c in Mycobacterium tuberculosis H37Rv

Annotation: Probable acetaldehyde dehydrogenase (acetaldehyde dehydrogenase [acetylating])

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 TIGR03215: acetaldehyde dehydrogenase (acetylating)" amino acids 4 to 297 (294 residues), 455.9 bits, see alignment E=2.7e-141 PF09290: AcetDehyd-dimer" amino acids 127 to 272 (146 residues), 204.4 bits, see alignment E=8.4e-65

Best Hits

Swiss-Prot: 100% identical to ACDH_MYCTO: Acetaldehyde dehydrogenase (mhpF) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K04073, acetaldehyde dehydrogenase [EC: 1.2.1.10] (inferred from 100% identity to mtb:TBMG_03575)

MetaCyc: 100% identical to propanal dehydrogenase (Mycobacterium tuberculosis H37Rv)
RXN-12736 [EC: 1.2.1.87]

Predicted SEED Role

"Acetaldehyde dehydrogenase, acetylating, (EC 1.2.1.10) in gene cluster for degradation of phenols, cresols, catechol" in subsystem Biphenyl Degradation or Central meta-cleavage pathway of aromatic compound degradation (EC 1.2.1.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.10 or 1.2.1.87

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (303 amino acids)

>Rv3535c Probable acetaldehyde dehydrogenase (acetaldehyde dehydrogenase [acetylating]) (Mycobacterium tuberculosis H37Rv)
MPSKAKVAIVGSGNISTDLLYKLLRSEWLEPRWMVGIDPESDGLARAAKLGLETTHEGVD
WLLAQPDKPDLVFEATSAYVHRDAAPKYAEAGIRAIDLTPAAVGPAVIPPANLREHLDAP
NVNMITCGGQATIPIVYAVSRIVEVPYAEIVASVASVSAGPGTRANIDEFTKTTARGVQT
IGGAARGKAIIILNPADPPMIMRDTIFCAIPTDADREAIAASIHDVVKEVQTYVPGYRLL
NEPQFDEPSINSGGQALVTTFVEVEGAGDYLPPYAGNLDIMTAAATKVGEEIAKETLVVG
GAR