Protein Info for Rv3533c in Mycobacterium tuberculosis H37Rv

Annotation: PPE family protein PPE62

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 582 PF00823: PPE" amino acids 5 to 162 (158 residues), 195.8 bits, see alignment E=5.3e-62 PF01469: Pentapeptide_2" amino acids 335 to 371 (37 residues), 31.9 bits, see alignment 9.6e-12 amino acids 392 to 429 (38 residues), 30 bits, see alignment 3.9e-11 amino acids 412 to 449 (38 residues), 33.8 bits, see alignment 2.5e-12 amino acids 422 to 459 (38 residues), 37.2 bits, see alignment 2.2e-13 amino acids 432 to 469 (38 residues), 36.6 bits, see alignment 3.3e-13 amino acids 451 to 489 (39 residues), 37.9 bits, see alignment 1.3e-13

Best Hits

Swiss-Prot: 100% identical to PPE62_MYCTU: Uncharacterized PPE family protein PPE62 (PPE62) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mtb:TBMG_03573)

Predicted SEED Role

"PPE family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (582 amino acids)

>Rv3533c PPE family protein PPE62 (Mycobacterium tuberculosis H37Rv)
MNYAVLPPELNSLRMFTGAGSAPMLAAAVAWDGLAAELGSAASSFGSVTSDLASQAWQGP
AAAAMAAAAAPYAGWLSAAAARAAGAAAQAKAVASAFEAARAATVHPLLVAANRNAFAQL
VMSNWFGLNAPLIAAVEGAYEQMWAADVAAMVGYHSGASAAAEQLVPFQQALQQLPNLGI
GNIGNANLGGGNTGDLNTGNGNIGNTNLGSGNRGDANLGSGNIGNSNVGGGNVGNGNFGS
GNGRAGLPGSGNVGNGNLGNSNLGSGNTGNSNVGFGNTGNNNVGTGNAGSGNIGAGNTGS
SNWGFGNNGIGNIGFGNTGNGNIGFGLTGNNQVGIGGLNSGSGNIGLFNSGTNNVGFFNS
GNGNLGIGNSSDANVGIGNSGATVGPFVAGHNTGFGNSGSLNTGMGNAGGVNTGFGNGGA
INLGFGNSGQLNAGSFNAGSINTGNFNSGQGNTGDFNAGVRNTGWSNSGLTNTGAFNAGS
LNTGFGAVGTGSGPNSGFGNAGTNNSGFFNTGVGSSGFQNGGSNNSGLQNAVGTVIAAGF
GNTGAQTVGIANSGVLNSGFFNSGVHNSGGFNSENQRSGFGN